KEGG   Yersinia enterocolitica subsp. palearctica 105.5R(r): YE105_C2300Help
Entry
YE105_C2300       CDS       T01480                                 

Definition
nicotinamidase/pyrazinamidase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
yep  Yersinia enterocolitica subsp. palearctica 105.5R(r)
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:yep00760]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2641165..2641830
Genome map
AA seq 221 aa AA seqDB search
MWMNAALLLIDLQNDFCPGGALAVAKGDAAIAVANEAITTCLARKIPIIASQDWHPAEHR
SFAVNSQAEPWTTGDLEGLTQVWWPVHCVQNSVGAALHPKLNQEVITQIFRKGQNPDIDS
YSAFFDNGRRAKTPLDDWLQQQGINCLFVMGLATDYCVKYTVLDALTLGYKTSVIKDGCR
GVNLQPQDSQLALDAMNEAGANIQSLAQFIAEVKAQAGSLD
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgtggatgaatgcagcgctgttgttaattgatttgcagaatgatttttgcccaggtggc
gcgttagctgttgccaagggtgacgcggctattgccgttgcaaatgaggctattactacc
tgtctggctcgcaaaataccgattatcgccagccaggattggcaccccgcagaacaccgc
agttttgctgtcaattcgcaggcagagccttggacgaccggtgatttggaagggttaacc
caagtgtggtggccggtgcattgtgttcagaattcagttggcgcagctttgcatccaaag
ttgaatcaagaggttattacccagattttccgtaaaggtcagaatccggatatcgacagc
tacagtgcttttttcgacaatggacggcgggcaaaaacaccgctggatgattggttacaa
caacaagggatcaattgcctgttcgttatgggattagcgacagattactgtgtgaaatac
accgtgttggatgcattaacattaggttataaaacatccgtcattaaggatgggtgccgt
ggcgtcaatttgcaaccacaagacagccaactagctcttgatgcgatgaatgaggccgga
gctaacatacagtcattggcgcaatttattgctgaagtaaaagcacaggctggctcactg
gattaa

DBGET integrated database retrieval system