KEGG   Yersinia enterocolitica subsp. palearctica 105.5R(r): YE105_C2887Help
Entry
YE105_C2887       CDS       T01480                                 

Definition
glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
yep  Yersinia enterocolitica subsp. palearctica 105.5R(r)
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:yep00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    YE105_C2887
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    YE105_C2887
   00052 Galactose metabolism
    YE105_C2887
   00500 Starch and sucrose metabolism
    YE105_C2887
   00520 Amino sugar and nucleotide sugar metabolism
    YE105_C2887
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    YE105_C2887
   00524 Butirosin and neomycin biosynthesis
    YE105_C2887
Enzymes [BR:yep01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     YE105_C2887
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3351497..3352468)
Genome map
AA seq 323 aa AA seqDB search
MTSYALVGDVGGTNARLALCAVATGEISQAKTYSGLDYDSLEAVIKQYLSEHKVTVEHAC
IAIACPITGDWVAMTNHTWAFSIAAMQQNLGLKHLEIINDFTAVSMAIPMLSPQDVLQFG
GTSPQPGKPVAVYGAGTGLGGAHLVNVDSRWISLPGEGGHVDFAPNSEEEDRILAVLRQE
LGHVSAERVLSGPGLVNLYRAIVISDGRLPENLVPKDVTERALADSCTDCRRALSLFCVI
MGRFGGNLALNLSTFGGVYIAGGIVPRFMEFFKASGFRGAFEDKGRFKDFLQDIPVYMIT
HQQPGLLGAGAYLRQKLGHRLHP
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgacgagctatgccctggtgggtgacgttggcggcactaatgcccgtttggcgctttgc
gctgtggcgacgggcgaaatatcacaagcaaaaacatattcagggttagattacgacagt
ctggaagctgtcattaagcaatatttatcagagcataaggtcactgtagagcatgcctgt
attgctatcgcctgcccgattaccggagattgggtggcaatgactaatcacacttgggca
ttctctatcgcggctatgcagcaaaacctcgggctgaagcacttagagatcattaatgat
ttcaccgcggtatcaatggcgatcccgatgttatcgccacaagatgtgctgcaatttggc
ggtacatcgccacagccaggtaaaccggtggcggtatacggggctgggacggggttaggg
ggggcacatttagttaatgtggatagccgctggataagcttgccgggtgaaggcgggcat
gtggattttgcgcccaatagcgaagaagaagaccggattttggcggtattgcgtcaggaa
ctgggccacgtctccgccgagcgagtgctttccgggccggggctggtcaatttataccgg
gccattgtgatttctgatggtcgtctgcccgaaaatctggtaccgaaagatgtgactgaa
cgtgctctggcagacagttgcactgattgtcgccgcgcattatcactgttttgcgtgatt
atggggcgctttggcggaaatttggccttgaatctcagcacattcggtggtgtgtatatc
gctggcggaattgtgccgcgctttatggaattctttaaagcttccggcttccgcggtgct
tttgaagataaagggcgtttcaaagatttcttacaggatattccggtctatatgatcacg
caccagcaacctggtttgctgggggcgggggcttatttgcggcagaagttagggcatcgc
cttcatccttga

DBGET integrated database retrieval system