KEGG   Yersinia enterocolitica subsp. palearctica 105.5R(r): YE105_C3255Help
Entry
YE105_C3255       CDS       T01480                                 

Definition
hydrogenase 2 large subunit
Orthology
K06281  
hydrogenase large subunit [EC:1.12.99.6]
Organism
yep  Yersinia enterocolitica subsp. palearctica 105.5R(r)
Pathway
Nitrotoluene degradation
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:yep00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    YE105_C3255
Enzymes [BR:yep01000]
 1. Oxidoreductases
  1.12  Acting on hydrogen as donor
   1.12.99  With other acceptors
    1.12.99.6  hydrogenase (acceptor)
     YE105_C3255
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3769656..3771350)
Genome map
AA seq 564 aa AA seqDB search
MSQRITIDPVTRIEGHLRIDCEIEDGKVIKAWSSGTMWRGMEEILQGNDPRDAWMIVQRI
CGVCTTIHAIASVRAVENALGMEVPVNAQHIRNLILAAHSIHDHIVHFYQLSALDWVDVT
SALQASPQKAAAMLSGLSSWPLNSAEEFTRVQQKIKDLVASGQLGIFANGYWGHPAMALP
PEVNLIAVAHYLQALECQRDANRIVAVLGGKTPHIQNLAVGGVANPINLDMPSVLNLERL
MLVKSFIDRLGSFIEQVYKVDTAVIAAHYPNWLNLGKGADYYLSVPELPIDRKGENFLLP
GGYLENGTFRPIANHNDPYLIKGIAESGKHAWYQDDEPLAPWEGKTNPNYTGWQEDGKYS
WVKAPTFYGKTVEVGPLAWLMCGLAAGHAPTKQHFTDIGAAYQKLSGQAITAEQLPSTLG
RIIGRAVHCCVLHETLAQQWTALVTNIGTGDIETFIKPNIPLSGEIRGVGFEEAPRGMLS
HWVVIKDGKIANYQAVVPSTWNAGPRNYNDEPGPYEQALVGTPVADPAKPLEVVRTIHSF
DPCMSCAVHIVDTTGNEVTKIKVL
NT seq 1695 nt NT seq  +upstreamnt  +downstreamnt
atgagccaacgcatcaccattgatcccgtcacccgtattgaggggcacctgcggatcgac
tgcgaaattgaggacggcaaagtcattaaagcctggtcctccggcaccatgtggcgtggc
atggaagaaattttacaaggcaatgatccgcgcgatgcctggatgattgtgcagcgcatt
tgcggcgtctgtaccactattcacgccattgcttcggtgcgggcagtggaaaatgcatta
gggatggaagtgccggttaatgcgcagcatatccgcaatttgattctggcggcgcacagt
attcatgaccatatcgtgcatttctatcaactctcggcactggattgggtggatgtcacc
tcggcactgcaagcctcaccacaaaaagcggcggcgatgctgagtggcttgtccagttgg
ccgctaaacagcgcggaagagttcacccgggtgcagcagaaaatcaaagatttggtcgcc
agcgggcagttaggtatttttgccaacggctattggggccatccggcgatggcattgccg
ccagaggtcaatttgattgcggtggcacattatctgcaagcgctggagtgccagcgcgat
gccaaccgtatagtggcggtgctcggcggcaaaacaccgcatattcagaatctggcagtg
ggcggggttgccaaccccatcaatctggatatgccaagtgtgctcaatcttgagcgcttg
atgctggtgaagtcttttattgatcggctgggcagctttattgagcaggtttataaggtc
gatacagcggtgatcgctgctcactatccgaactggctcaatttaggcaaaggagcggat
tactatctcagcgtgccggagttacctattgatcgcaaaggggaaaatttcctgttgccg
gggggatatctggaaaacggcactttccgcccgattgccaatcacaacgatccgtatttg
atcaaaggtattgccgagagcggcaaacacgcctggtatcaggacgacgaaccgctcgcg
ccgtgggaggggaaaaccaacccgaactacaccggctggcaggaagacggcaaatattcg
tgggtaaaagcgccgactttctacggcaaaacggtggaagtggggccgctggcgtggtta
atgtgcgggttggccgccggacacgccccaaccaaacaacatttcactgacatcggcgcg
gcttaccaaaaactgagcgggcaggccattactgctgaacagttgccctcgactctgggg
cgcattattggccgggcggtgcattgctgtgtgctgcatgaaaccttggcccagcaatgg
acggcgctggtcaccaatattggtactggtgatatcgaaacctttatcaagccgaatatt
ccattaagcggcgaaatccgtggtgtgggctttgaagaagcgccgcgcggcatgttgtcg
cactgggtggtcatcaaggatggcaaaatcgccaactatcaggcggtggtgccatcaacc
tggaatgctggcccacgcaattataatgatgagccggggccatacgagcaagcgctggtg
gggacaccggttgcagatcctgccaaaccactggaagtggtgcgaaccattcactcattc
gacccctgtatgtcttgtgctgtacatattgttgatacaacgggcaacgaagtgaccaaa
atcaaggtgctgtga

DBGET integrated database retrieval system