KEGG   Yersinia enterocolitica subsp. palearctica 105.5R(r): YE105_C3473Help
Entry
YE105_C3473       CDS       T01480                                 

Definition
aspartate carbamoyltransferase catalytic subunit
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
yep  Yersinia enterocolitica subsp. palearctica 105.5R(r)
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Module
Uridine monophosphate biosynthesis, glutamine (+ PRPP) => UMP
Brite
KEGG Orthology (KO) [BR:yep00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    YE105_C3473
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    YE105_C3473
Enzymes [BR:yep01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     YE105_C3473
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3996187..3997122
Genome map
AA seq 311 aa AA seqDB search
MVNPLYHKHIISINDLCREELVLVLRTAASLKSHPQPELLKHKVIASCFFEASTRTRLSF
ETSIHRLGASVVGFSDSSNTSLGKKGETLADTMSVISTYVDAIVMRHPQEGAARLATQFS
GNVPVVNAGDGANQHPTQTLLDLFTIQETQGRLDNINIAMVGDLKYGRTVHSLTQALAKF
NGNRFFFIAPDALAMPAYLLEMLKEKGIEYSLHESIEEVVPELDILYMTRVQKERLDPSE
YANVKAQFVLRAADLNGAQDNLKVLHPLPRIDEITTDVDKTPYAYYFQQAGNGIFARQAL
LALVLNADLAL
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atggtcaacccgttgtatcacaagcatatcatctcaattaacgacttatgtcgcgaggaa
ctggtactggtactgcgcaccgccgccagtttgaaaagccacccgcaacccgagctgtta
aaacacaaagtgatcgccagttgctttttcgaagcctcaacccgcacccgtttgtcgttt
gaaacctcgattcatcgccttggggcatccgttgtcggtttttctgatagcagcaacacc
tcgctgggtaagaaaggtgagacactggctgataccatgtcagtcatcagtacctatgtc
gatgccattgtcatgcgccatccacaagaaggggcggcacgccttgccacccagttctca
ggcaatgtgccggtggtcaatgccggtgatggtgccaaccaacatccaacccaaacactg
ctcgatttattcactattcaggaaacccagggccgactggataacatcaatatcgctatg
gtcggtgatctaaaatatggccgcaccgtgcattcactgacgcaagcgctggcaaaattt
aacggcaatcgcttcttctttatcgcccctgatgcattagcaatgccagcttatcttctt
gaaatgctgaaagaaaaaggcatcgaatacagtctgcacgaaagtattgaagaagtggta
ccagagctggatattctctatatgacccgcgtgcaaaaagaacgccttgacccatcagaa
tatgccaacgtcaaagcacagtttgtcctgcgcgcggctgatttaaatggcgcacaagat
aatctcaaagtgctgcacccgctgccacgtattgatgaaatcaccaccgatgttgataaa
accccttacgcctactatttccaacaagcaggtaatgggatttttgcacgtcaggcgctg
ttggcgctggtactcaacgcagatttggctctttaa

DBGET integrated database retrieval system