KEGG   Yersinia enterocolitica subsp. palearctica 105.5R(r): YE105_C3720Help
Entry
YE105_C3720       CDS       T01480                                 

Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
yep  Yersinia enterocolitica subsp. palearctica 105.5R(r)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:yep00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4269470..4271566)
Genome map
AA seq 698 aa AA seqDB search
MDRKSLDQAATLAGIAANYINAHGKSQAISAQTKQQLLAAMGRTSMPPDSQTEKAPLPPV
KIFTFGSAMQLPMAGSGDYHWQLQTEKGDLHQGRISAKKTLTLPASLPQGYHRLVLEQGL
QQWQCSVIVAPKRCYEPDALLAGKKLWGACVQLYTLRSDHNWGIGDFGDLNQMLEQVGER
GGAFIGLNPIHALYPANPHSASPYSPSSRRWLNVIYIDVNRVDEFQHSEAAQIWWHQPET
QGALARARASEWVDYPQVMQLKLTALRLAFPLFTARKTKDARVQAFHRFVEQGGSSLHQQ
AAFDALHAHLSKNDPMMWGWPVWPEKYRDGHSSAVADFSREHADEVNFYLWLQWLAASQF
EDCFRASQTWKMPLGLYRDLAVGVAEGGAETWCDRELYCLKASVGAPPDILGPLGQNWGL
PPMDPHVMAARAYQPFIDLLRANMTSCGALRIDHVMALLRLWWIPYGQTADQGAYVKYPV
DDLLAILALESQRHRCMVIGEDLGTVPVEIVGKLRDSGVYSYKVLYFEHDSENTFRAPQS
YPVQAMATITTHDLPTLRGYWQSDDLTLGNKLGLYPDQQILKQLYLDRERAKQGLLEGLH
HYDCVPKKVGHKASLLSMSPVLNRGLQRYVADSASALLGLQPEDWLDMAAPVNIPGTTDE
YPNWRRKLTSSLEEMFADDQVNRLLKDLDKRRKNVSAG
NT seq 2097 nt NT seq  +upstreamnt  +downstreamnt
atggatcgtaaatcgctcgatcaagcagcgacactggcagggattgccgccaattatatt
aatgcgcatggtaagtcgcaggctatttcagcacaaaccaagcagcagttgttggcggcc
atgggacgcaccagtatgcccccagattctcagacagaaaaagcaccattaccaccggta
aaaatatttacttttggcagcgcaatgcaactgccaatggcgggatcaggcgattatcac
tggcagttacagaccgaaaaaggtgatttgcatcaagggcgtatcagcgccaaaaaaacg
ctgacattgccggcctcactgccgcaaggctatcaccgcttggtattggaacaaggctta
cagcagtggcagtgctcggttatcgtcgctccgaaacgttgctatgagccagatgccttg
ctggcagggaaaaaactctggggagcctgtgttcagttgtataccctgcgctccgatcat
aactggggtatcggtgattttggcgacctcaaccagatgttggagcaggtcggtgagcgc
ggtggggcctttattggtcttaacccgattcatgcactgtatccggccaacccacatagt
gccagcccttacagcccttcttcccggcgctggctgaatgtgatttatattgatgtcaat
cgcgtggatgaattccagcatagcgaggcggcgcagatctggtggcatcagcccgagaca
caaggcgcgctggcgagagcgcgtgccagtgaatgggttgattatccgcaggtcatgcag
ctcaagttgaccgctttgcgtttggctttcccactttttacggcgcgcaaaaccaaagat
gctcgggtacaggcattccatcgttttgttgaacagggtggaagtagcctgcatcaacag
gccgcttttgatgctttgcatgctcatttgagtaaaaacgaccccatgatgtggggctgg
ccagtatggccggaaaaatatcgtgatgggcacagcagtgctgtggctgatttcagtcgt
gagcatgctgatgaagtgaacttctatctgtggctacagtggttggcggccagccagttt
gaggactgcttccgtgccagccaaacatggaaaatgccgttggggttgtatcgcgatttg
gcggtaggtgttgcagaaggcggcgctgaaacttggtgcgatcgcgagttatattgcctt
aaagcctcagtgggagcgccgcccgatattttagggccgctgggccagaactgggggttg
ccaccaatggatccgcacgtcatggctgctcgcgcttatcagccttttattgatttgttg
cgggctaatatgaccagttgcggtgcgctgcgcattgatcacgtgatggcgttattgcgc
ttgtggtggattccttacggccaaaccgcggatcaaggggcttatgtcaaatacccggtc
gatgatctgctggcgatattagcgttagaaagtcagcgccatcgctgcatggtgattggt
gaagatttaggcacggtgccggttgagattgtcggtaagctgcgcgacagcggagtgtat
tcctataaagtgctctattttgagcatgacagcgaaaacacgttccgtgcgccacagtct
tatccggtacaagcgatggcaaccatcaccactcatgatctgccgacgctgcgcggttat
tggcaaagtgatgatttgacgttggggaataagctggggctatatccggaccaacagata
ttgaaacagctttatcttgatagggaacgtgcgaaacaaggcttgctggaagggttgcat
cattatgattgcgtgccaaagaaagtgggtcataaagcgtcgttgctgtcgatgagcccg
gttcttaatcgtggattgcagcgctatgttgccgacagtgccagtgcattattgggtttg
cagccggaagattggctggatatggccgcgccggtcaacattcctggcaccactgatgag
tatccaaactggcggcgtaagttgacctcaagcttggaagagatgttcgcagacgaccag
gttaatcgtttattgaaagatttggataagcgacgtaagaatgtttcagcggggtga

DBGET integrated database retrieval system