KEGG   Yersinia enterocolitica subsp. palearctica 105.5R(r): YE105_C3791Help
Entry
YE105_C3791       CDS       T01480                                 

Definition
endo-1,4-D-glucanase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
yep  Yersinia enterocolitica subsp. palearctica 105.5R(r)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:yep00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4371433..4372560)
Genome map
AA seq 375 aa AA seqDB search
MVVMFKRLVCILLLLASFGTAAACDWPAWQQFKQHYISESGRVIDPSNPRKVTTSEGQSY
GLFFALVADDHETFDRLLTWTENNLSAGDLTARLPAWLWGQRNGHSWDILDPNSASDADL
WIAYSLLEAGRLWDTRRYQTMGTLLLQRIAKEEVVNIPGLGEMLLPGKIGFKNEDRWRLN
PSYLPPQLLARFSALAGPWKEMVKTNQRLWLETAPRGFSPDWVVWQKDKGWQPDETHPNL
GSYDAIRTYLWAGMLSNSSPQKAALIQHFQPMAEVTQQQGLPPEKADTLTGKTTGDGPVG
FSAALLPFLASSPAPFNQQALSQQQKRVQDSPPGADAYYSAVLTLFGQGWAQHRYSFNRQ
GELQPSWNSQCATLK
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atggtcgtgatgtttaaacgactggtatgcatcctgctgctgcttgccagttttggtacc
gcagcagcttgtgattggccagcatggcagcagttcaaacaacactatatcagtgagtca
gggcgggttatcgaccccagcaacccgaggaaagtcaccacgtcggaggggcaaagttac
ggcttgttttttgcgctggtggctgatgatcacgagacattcgatcgattactcacttgg
acagaaaataacttgtcagcgggagatttgaccgcccgtctacctgcatggttatggggg
caacgtaatggtcatagctgggatattttggatccaaattcggcttcggatgcggattta
tggattgcttacagtttattagaggctggtcgattatgggatacccgccgttaccagact
atgggcaccttattattgcaacgcattgccaaagaagaagtggtgaatattcccggcttg
ggtgaaatgttattaccgggcaaaattggctttaagaatgaagaccgttggcggctcaac
ccaagctatttaccaccacaattgctggcacgtttttctgctctggctgggccgtggaaa
gaaatggtgaaaaccaatcagcggctatggctggaaacagcaccgcgtggtttcagccct
gactgggtggtgtggcaaaaagataaaggctggcagccggatgaaactcacccaaatctc
ggtagctacgatgcgattcgtacttacttatgggccgggatgttatcaaatagcagtccg
caaaaggcggcacttatccaacacttccaaccgatggctgaagtcacccagcagcaaggt
ttgccaccagaaaaggccgacacgttgacgggcaaaacaaccggtgatgggccggttggc
ttttcggcggcattattaccgtttttagccagcagtcctgcaccgtttaatcagcaggcg
cttagccaacaacaaaaacgggtacaagattcacctccgggagccgatgcttactacagt
gcagtgctgacactgtttggtcagggatgggcacaacatcgttatagctttaatcggcag
ggtgagcttcagccctcatggaacagtcaatgcgcaacattaaaataa

DBGET integrated database retrieval system