KEGG   Yersinia enterocolitica subsp. palearctica 105.5R(r): YE105_C3791Help
Entry
YE105_C3791       CDS       T01480                                 

Definition
endo-1,4-D-glucanase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
yep  Yersinia enterocolitica subsp. palearctica 105.5R(r)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:yep00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    YE105_C3791
Enzymes [BR:yep01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     YE105_C3791
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4371433..4372560)
Genome map
AA seq 375 aa AA seqDB search
MVVMFKRLVCILLLLASFGTAAACDWPAWQQFKQHYISESGRVIDPSNPRKVTTSEGQSY
GLFFALVADDHETFDRLLTWTENNLSAGDLTARLPAWLWGQRNGHSWDILDPNSASDADL
WIAYSLLEAGRLWDTRRYQTMGTLLLQRIAKEEVVNIPGLGEMLLPGKIGFKNEDRWRLN
PSYLPPQLLARFSALAGPWKEMVKTNQRLWLETAPRGFSPDWVVWQKDKGWQPDETHPNL
GSYDAIRTYLWAGMLSNSSPQKAALIQHFQPMAEVTQQQGLPPEKADTLTGKTTGDGPVG
FSAALLPFLASSPAPFNQQALSQQQKRVQDSPPGADAYYSAVLTLFGQGWAQHRYSFNRQ
GELQPSWNSQCATLK
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atggtcgtgatgtttaaacgactggtatgcatcctgctgctgcttgccagttttggtacc
gcagcagcttgtgattggccagcatggcagcagttcaaacaacactatatcagtgagtca
gggcgggttatcgaccccagcaacccgaggaaagtcaccacgtcggaggggcaaagttac
ggcttgttttttgcgctggtggctgatgatcacgagacattcgatcgattactcacttgg
acagaaaataacttgtcagcgggagatttgaccgcccgtctacctgcatggttatggggg
caacgtaatggtcatagctgggatattttggatccaaattcggcttcggatgcggattta
tggattgcttacagtttattagaggctggtcgattatgggatacccgccgttaccagact
atgggcaccttattattgcaacgcattgccaaagaagaagtggtgaatattcccggcttg
ggtgaaatgttattaccgggcaaaattggctttaagaatgaagaccgttggcggctcaac
ccaagctatttaccaccacaattgctggcacgtttttctgctctggctgggccgtggaaa
gaaatggtgaaaaccaatcagcggctatggctggaaacagcaccgcgtggtttcagccct
gactgggtggtgtggcaaaaagataaaggctggcagccggatgaaactcacccaaatctc
ggtagctacgatgcgattcgtacttacttatgggccgggatgttatcaaatagcagtccg
caaaaggcggcacttatccaacacttccaaccgatggctgaagtcacccagcagcaaggt
ttgccaccagaaaaggccgacacgttgacgggcaaaacaaccggtgatgggccggttggc
ttttcggcggcattattaccgtttttagccagcagtcctgcaccgtttaatcagcaggcg
cttagccaacaacaaaaacgggtacaagattcacctccgggagccgatgcttactacagt
gcagtgctgacactgtttggtcagggatgggcacaacatcgttatagctttaatcggcag
ggtgagcttcagccctcatggaacagtcaatgcgcaacattaaaataa

DBGET integrated database retrieval system