KEGG   Yersinia enterocolitica subsp. palearctica 105.5R(r): YE105_C3830Help
Entry
YE105_C3830       CDS       T01480                                 

Definition
beta-glucosidase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
yep  Yersinia enterocolitica subsp. palearctica 105.5R(r)
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:yep00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    YE105_C3830
Enzymes [BR:yep01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     YE105_C3830
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4418888..4420288
Genome map
AA seq 466 aa AA seqDB search
MTTYQFPAGFFWGAAASGPQTEGTDNKPHRSIWDSWFASHPERFFQQIGPTKVCETLHKY
KEDVALMKNIGFNSFRTSIQWSHLIEDFETGKPNDDAVRFYHDYFDEMIRNGIEPIINLY
HFDMPEELQNRYGGFESRHVAELFGRFAKTAFELFGHKIKYWTTFNEPIVPVEGGYLYDF
HYPCKKDGKLAAQVAFNIMLAHAKAVKCYREQQLTGDIGVVLNLTPSYTRSDSPEDHKAA
WYADLLFNRSFLDPLVKHQFPKELCEILATHDCLPIVSKEDVCSITDSRIDFLGVNYYVP
RRVKARESEYTLDYFTPEYYFENYVDPDGRFNPYRDNNEILPQAIYDIAANIRDNYENIK
WYLAEIGIAMDLASEGPIQADGVIDDSFRIALMEEHLVQLHRAINDGANCFGVHQWTFID
NWSWINSFKRRYGFYRLDLATGERQIKRNGLWFKSLAETNQFCRQD
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgacaacatatcagttccctgctggttttttctggggggcagcggcgtctggcccacag
actgaaggcactgacaataaaccgcaccgatccatttgggacagctggtttgccagtcat
ccagagcgtttctttcagcaaatcggcccgaccaaagtgtgcgaaacgctgcacaaatat
aaagaagacgtcgcgctgatgaaaaacattggctttaactcatttcgcacgtcaattcag
tggtcgcatttgattgaggattttgaaacaggtaaaccgaacgatgatgcggtgcgcttt
tatcatgactattttgacgagatgatccgcaatggcattgaaccaataattaatctttat
cattttgatatgccagaagaattacagaatcgttatggtgggtttgaatctcgccacgtc
gccgagctgttcggccgttttgccaaaacagcttttgaactatttggtcataaaatcaaa
tactggaccactttcaatgagccgatcgtcccggtggaaggcggatatctatatgacttc
cattacccgtgtaaaaaagatggcaaactggccgctcaggtagcattcaatatcatgctg
gcacacgccaaagcggtaaaatgttaccgcgaacagcaacttaccggagatattggtgtg
gtactcaaccttacaccttcctatacccgtagtgattcgcccgaagaccataaagcggcc
tggtatgccgatttactgtttaaccgcagcttcctcgaccctttagtgaaacatcagttc
cccaaagaactgtgtgaaatactggctactcacgattgcctacccatcgtcagcaaagaa
gatgtctgctcaattaccgactctcgcatagattttttaggggtaaattactatgttcca
cgtcgggtaaaggcacgcgaaagtgaatacacccttgattattttaccccagaatattac
ttcgaaaactatgtcgatcctgatggtcgttttaacccctaccgtgataataacgaaatt
ctgccgcaggctatttatgatattgcggccaatattcgtgacaattacgagaatataaaa
tggtatctggctgaaattggcattgccatggatttggcatcagaagggccaatacaggca
gatggcgtgattgatgacagttttcgtattgccctaatggaagaacatttggttcagttg
catcgggcaatcaatgatggagcgaattgttttggtgtacatcagtggacgtttattgat
aactggtcatggattaactcttttaaacggcgttacggcttctatcggctggatttggcc
acgggcgaacggcaaataaaacgcaatggattgtggtttaaatctcttgctgaaactaac
caattttgccgtcaggattaa

DBGET integrated database retrieval system