KEGG   Yersinia enterocolitica subsp. palearctica 105.5R(r): YE105_C3850Help
Entry
YE105_C3850       CDS       T01480                                 

Definition
xylose isomerase
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
yep  Yersinia enterocolitica subsp. palearctica 105.5R(r)
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:yep00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    YE105_C3850
   00051 Fructose and mannose metabolism
    YE105_C3850
Enzymes [BR:yep01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     YE105_C3850
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4444682..4446001
Genome map
AA seq 439 aa AA seqDB search
MSSYFDKLEQVRYEGSQSFNPLAFHHYNPDEIILGKRMADHLRFAACYWHTFCWGGADMF
GSNAFERPWQQSGDALALAKSKADVAFEFFHKLNVPYYCFHDVDVSPEGTSLKEYLNNFA
VMTDVLAEKQESSGVKLLWGTANCFTHPRYGAGAATNPNPEVFSWAATQVFTAMNATQKL
GGENYVLWGGREGYETLLNTDLRQEREQIGRFMQMVVEHKHKTGFQGTLLIEPKPQEPTK
HQYDYDVATVYGFLKQFGLEKEIKVNIEANHATLAGHSFHHEIASAIALGIFGSVDANRG
DPQLGWDTDQFPNSVEENALVMFEILKAGGFTTGGLNFDAKVRRQSTDKYDLFYGHIGAM
DTMALALKIAAKMIEDGQLDKQVAERYAGWNSDLGQQILKGKMSLEDLASYAEQHNLNPH
HQSGHQELLENRVNSYIFG
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgtcatcttattttgataaattagaacaagtgcgttacgaaggcagccagagctttaac
ccactggcatttcatcactacaatccggatgaaattatccttggtaagcgaatggccgat
cacctaaggttcgctgcctgctactggcataccttctgctggggcggggcggatatgttt
ggcagcaatgcctttgagcgcccatggcaacaatctggagatgcattggctttggcaaaa
agtaaagctgatgtggcttttgaattcttccataaactgaatgtgccttattactgcttc
cacgatgtggatgtttcacccgaaggcacatcattaaaagaatatttaaataattttgcc
gtcatgactgatgtattagctgagaagcaagaaagtagcggcgtaaaattattatggggc
accgccaactgcttcacccacccgcgctacggtgccggggcggcgaccaatccaaatcca
gaagtttttagctgggcggcaacccaagtctttaccgccatgaatgccacccaaaaactc
ggtggggaaaactatgtgttgtggggcggacgcgaaggctatgaaacactgttaaataca
gatttacggcaagaacgtgagcaaattggccgctttatgcaaatggtggtcgaacataaa
cacaagacgggcttccagggcacattgttgatcgagccaaaaccacaagagccgactaag
catcagtatgattatgatgttgctacagtttatggtttcctcaagcagtttgggctagaa
aaagagattaaagttaacattgaagctaaccatgcgactttggctggacactctttccat
catgagattgccagtgcgattgcattaggtattttcggttcggtggatgctaaccgtggc
gatccacaattaggttgggataccgaccagttcccgaacagtgtggaagaaaatgcgctg
gtgatgtttgaaatcctcaaagccggtggctttactaccggtgggctgaactttgatgcc
aaagtacgccgccaaagcacagataaatatgacctgttctatggccatattggggcaatg
gacaccatggctttagcactgaagattgcagcaaaaatgattgaagatggtcaattagat
aagcaagttgctgaacgttatgccggttggaatagcgatttggggcaacaaatcctaaaa
ggcaaaatgtcgctggaagatttagcgtcctatgccgagcaacataatctgaatccacat
caccaaagcgggcatcaagaactgctggaaaatagggttaacagctatatcttcggctga

DBGET integrated database retrieval system