KEGG   Yersinia enterocolitica WA: CH47_2925Help
Entry
CH47_2925         CDS       T03643                                 

Gene name
scrB
Definition
(GenBank) sucrose-6-phosphate hydrolase
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
yew  Yersinia enterocolitica WA
Pathway
yew00052  Galactose metabolism
yew00500  Starch and sucrose metabolism
yew01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:yew00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    CH47_2925 (scrB)
   00500 Starch and sucrose metabolism
    CH47_2925 (scrB)
Enzymes [BR:yew01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     CH47_2925 (scrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C Glyco_hydro_43
Motif
Other DBs
NCBI-ProteinID: AJI82007
UniProt: A0A0T9S9L0
Position
3169343..3170752
Genome map
AA seq 469 aa AA seqDB search
MQEASLLKHLTLAVMRGQGRALQDPHRPGWHLAPCVGLLNDPNGFIYHAGYYHLFYQWNP
LDCRHGSKYWGHWRSTDLVHWEHQPVALVPSEAYESDGCYSGSAVIADDLITLIYTGNVK
YPDGSRTAFQCLAQENERGEFDKLGPVLPLPAGYTGHVRDPKVWQHDGQWYMVLGAQDQQ
LQGKVLLLRSGDLREWHNLGEIAGSGLGGLGPFGYMWECPDLFTLADKDVLIFCPQGIPA
EAERYRNTFQAGYLLGKLDYANTTFNHQAFHELDAGFEFYAPQTTLAADGRRLLFGWMGI
PDEDEFYQPTVEYGWIHTMTCPRELSLNGDKLIQQPARELAALRCEHTQWQGRAQEAPAL
AIGSAEMIIDVSAPFTLELGNTLLLEWDGACLILSRNNLRTGLREFRYWRGQLQQLQLLC
DRCSIEIFINQGQAVMTSSYFPPVPPQAIFTGSAELRVQHWLLSSPMLE
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgcaagaagccagtttgcttaaacatcttacgctggcagtgatgcgcggtcagggccgc
gcattacaagacccacaccggccgggctggcacttagctccctgtgtcgggttgctgaat
gatcccaatgggtttatttatcatgctggctattatcatctgttttatcaatggaatccg
ctggattgccgccacggcagtaaatattggggccactggcgcagcactgacttagtgcat
tgggaacatcaaccagtggcattggtgccaagcgaagcctatgaaagtgatggttgttac
tccggttcggcggtgattgctgatgaccttatcaccttgatttacaccggaaatgtgaaa
taccccgatggctcccgtaccgcattccaatgtctggcacaggaaaatgaacggggcgag
ttcgacaagttagggccagtgctcccattgcccgctggctataccggacatgtgcgtgac
ccgaaagtctggcagcacgacggccagtggtacatggtgttaggcgctcaggaccaacaa
ctacaaggcaaggtgctactgctgcgctctggtgatttacgcgaatggcataacctcggt
gagatagctggctctggtctgggggggctggggccttttggctatatgtgggaatgcccc
gacctgtttaccctggcagataaagacgttttgattttctgcccacagggtataccagcc
gaagctgaacgctatcgtaatacctttcaggccggctatttactgggcaaattagattat
gccaacaccaccttcaatcatcaggcattccacgagttggacgctggctttgagttctat
gcgccgcaaaccacgctagccgcagatggtcgtcgcttattattcggctggatgggcatt
ccagatgaagatgaattttatcaaccaacagtggaatatggctggatccacaccatgact
tgcccacgcgagttgagtcttaatggcgacaaactgattcagcaaccggcccgtgagtta
gccgcgctgcggtgtgaacatacgcagtggcaaggccgtgcccaagaagcccctgctctt
gcgatcggtagcgccgaaatgataatcgacgtcagtgcgccttttaccctcgaattgggc
aatacattgctgttggaatgggatggtgcatgcttgattttaagccgtaataatctgcgc
accggattgcgggaattccgttactggcgcggtcaactgcaacaattacagttactttgt
gatcgttgcagcatagagatttttatcaatcagggacaagcggtgatgacgtcgagttac
ttcccaccagtaccgccacaagccatttttacgggaagtgctgaactgcgagtgcaacac
tggctgttgtcttcgcccatgttagaatga

DBGET integrated database retrieval system