KEGG   Yersinia enterocolitica subsp. palearctica Y11: Y11_00271Help
Entry
Y11_00271         CDS       T02010                                 

Definition
(GenBank) N-succinyl-L,L-diaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
yey  Yersinia enterocolitica subsp. palearctica Y11
Pathway
yey00300  Lysine biosynthesis
yey01100  Metabolic pathways
yey01120  Microbial metabolism in diverse environments
yey01230  Biosynthesis of amino acids
Module
yey_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:yey00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Y11_00271
Enzymes [BR:yey01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     Y11_00271
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28
Motif
Other DBs
NCBI-ProteinID: CBY28154
UniProt: A0A0H3P0B1
Position
complement(20255..21382)
Genome map
AA seq 375 aa AA seqDB search
MICPVIDLAQQLIKRPSLSPNDAGCQEIMIQRLEAIGFTVEPMNFGDTLNFWAWRGEGET
LAFAGHTDVVPTGDESHWSSPPFEPTIRDGMLYGRGAADMKGSLAAMVVAAERFVAAHPN
HKGRLAFMITSDEEAKAINGTVKVVNALMARHERLDYCLVGEPSSTDRVGDVVKNGRRGS
ITANLHIHGIQGHVAYPHLADNPVHRAIPALNELVATQWDEGNEFFPATSMQIANLHAGT
GSNNVIPGEFYVQFNFRFSTELTDSMIKQRVETLLERHQLDYTLEWVLSGQPFLTARGAL
VDAVVNAVEHYAEITPQLLTTGGTSDGRFIALMGAQVVELGPVNATIHKVNECVHAADLQ
LLSRMYQKIMEQLIA
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgatctgtccggtaatcgacctggcccaacaattaattaagcgcccgtcgctcagccct
aatgatgcaggttgccaggagatcatgattcagcgtttagaagctatcggttttactgtc
gaaccgatgaattttggcgacactctcaacttctgggcctggcgtggcgaaggcgagaca
ttggcgtttgctggtcataccgatgtggttcctaccggcgatgaaagccactggagcagc
ccaccgtttgagccaaccattcgcgatggcatgctgtatggccgtggtgctgccgacatg
aaaggttcactggcggcgatggtggttgcggcggagcgctttgtggccgcacatcctaat
cataaaggtcgcctggcatttatgattacctccgatgaagaagccaaagctattaatggc
accgttaaagtggttaacgccctgatggcacgtcatgagcggttggattactgcctggta
ggtgagccatccagtaccgaccgcgtcggcgatgtggtgaaaaatggtcgccgaggctct
atcaccgccaacttacacatccacggtatccaagggcatgtggcttatcctcatctggct
gataaccccgttcaccgtgcgatacccgcgctgaatgaactggtggcgacacaatgggac
gaaggcaatgagttcttccccgccaccagcatgcaaatcgctaacttgcatgccggtact
ggcagcaataacgtgattcccggtgagttctatgtgcagttcaatttccgcttcagcact
gaactgactgatagcatgattaagcagcgggttgagacattgctggagcgccatcaactc
gattataccctggaatgggttctatctggtcagccattcctgactgcgcgtggtgcgttg
gttgatgctgtggtcaatgccgttgagcattacgccgagataacgccgcaactgttgacc
accggtggcacctctgatggccggtttattgccttaatgggggcacaagtggttgaactg
gggccagttaatgccacaatccataaagtgaatgaatgtgttcacgctgctgatttacaa
ctgctaagccggatgtatcagaaaatcatggagcaactcatcgcatga

DBGET integrated database retrieval system