KEGG   Yersinia enterocolitica subsp. palearctica Y11: Y11_00921Help
Entry
Y11_00921         CDS       T02010                                 

Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
yey  Yersinia enterocolitica subsp. palearctica Y11
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:yey00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Y11_00921
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Y11_00921
   00052 Galactose metabolism
    Y11_00921
   00500 Starch and sucrose metabolism
    Y11_00921
   00520 Amino sugar and nucleotide sugar metabolism
    Y11_00921
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Y11_00921
   00524 Butirosin and neomycin biosynthesis
    Y11_00921
Enzymes [BR:yey01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Y11_00921
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
83583..84554
Genome map
AA seq 323 aa AA seqDB search
MTSYALVGDVGGTNARLALCAVATGEISQAKTYSGLDYDSLEAVIKQYLSEHKVTVEHAC
IAIACPITGDWVAMTNHTWAFSIAAMQQNLGLKHLEIINDFTAVSMAIPMLSPQDVLQFG
GTSPQPGKPVAVYGAGTGLGVAHLVNVDSRWISLPGEGGHVDFAPNSEEEDRILAVLRQE
LGHVSAERVLSGPGLVNLYRAIVISDGRLPENLVPKDVTERALADSCTDCRRALSLFCVI
MGRFGGNLALNLSTFGGVYIAGGIVPRFMEFFKASGFRGAFEDKGRFKDFLQDIPVYMIT
HQQPGLLGAGAYLRQKLGHRLHP
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgacgagctatgccctggtgggtgacgttggcggcactaatgcccgtttggcgctttgc
gctgtggcgacgggcgaaatatcacaagcaaaaacatattcagggttagattacgacagt
ctggaagctgtcattaagcaatatttatcagagcataaggtcactgtagagcatgcctgt
attgctatcgcctgcccgattaccggagattgggtggcaatgactaatcacacttgggca
ttctctatcgcggctatgcagcaaaacctcgggctgaagcacttagagatcattaatgat
ttcaccgcggtatcaatggcgatcccgatgttatcgccacaagatgtgctgcaatttggc
ggtacatcgccacagccaggtaaaccggtggcggtatacggggctgggacggggttaggg
gtggcacatttagttaatgtggatagccgctggataagcttgccgggtgaaggcgggcat
gtggattttgcgcccaatagcgaagaagaagaccggattttggcggtattgcgtcaggaa
ctgggccacgtctccgccgagcgagtgctttccgggccggggctggtcaatttataccgg
gccattgtgatttctgatggtcgtctgcccgaaaatctggtaccgaaagatgtgactgaa
cgcgctctggcagacagttgcactgattgtcgccgcgcattatcactgttttgcgtgatt
atggggcgctttggcggaaatttggccttgaatctcagcacattcggtggtgtgtatatc
gctggcggaattgtgccgcgctttatggaattctttaaagcttccggcttccgcggtgct
tttgaagataaagggcgtttcaaagatttcttacaggatattccggtctatatgatcacg
caccagcaacctggtttgctgggggcgggggcttatttgcggcagaagttagggcatcgc
cttcatccttga

DBGET integrated database retrieval system