KEGG   Yersinia enterocolitica subsp. palearctica Y11: Y11_02901Help
Entry
Y11_02901         CDS       T02010                                 

Definition
6-phospho-beta-glucosidase (EC:3.2.1.86)
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
yey  Yersinia enterocolitica subsp. palearctica Y11
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:yey00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Y11_02901
Enzymes [BR:yey01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     Y11_02901
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
295101..296537
Genome map
AA seq 478 aa AA seqDB search
MSHKQLPKDFLWGGAVAAHQVEGGWDKGGKGVSIADVLSGGAHGVDRVMTDGVQEGYRYP
NHEAVDFYGHYKEDIALFAEMGFKCFRTSIAWTRIFPKGDELQPNEAGLQFYDDMFDELL
KYGIEPVITLSHFEMPWHLVKEYGGWKNRKVVDFFVKFSVVVMERYKSKVKYWMTFNEIN
NQRNWKYPLFGYCCSGVVFTEQENPEETMYQVLHHQFVASAKVVKLGHAINPEFKIGCMV
AMVPLYPFSCHPDDMMYSVEAMRERYLFGDVHMRGYYPSYILNEWERRGFTINMEEGDLD
TLREGCADYMGLSYYMSNAVSAVNPGSGNSLSGFEGSVPNPHVKASDWGWQIDPVGLRYS
LSVLYERYQKPLFIVENGFGAIDKVADDGMVHDDYRIAYLKAHIEQMKKAVFEDGVDLMG
YTPWGCIDCVSFTTGEYSKRYGFIYVDKNDDGTGTMARSRKQSFDWYKKVIASNGEEL
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atgagccacaaacaattaccgaaagattttttatggggcggcgcagttgcggcacatcag
gttgaaggcggctgggataaaggcggcaaaggtgtaagcattgccgatgtattgtccggt
ggcgctcacggtgttgaccgagttatgactgatggcgtgcaagagggttatcgctatcca
aaccatgaagcggttgatttttatggtcattataaagaagacatcgcgctgttcgccgaa
atgggcttcaaatgcttccgtacttccattgcctggacgcgtatttttccgaagggtgat
gagttgcaaccgaatgaagcgggtctgcaattttacgatgatatgtttgatgagttgctg
aaatacggtatcgaaccggttattacgctatctcattttgaaatgccgtggcacttggtt
aaagaatacggtggctggaaaaatcggaaagtggtcgactttttcgtgaaattcagtgta
gtggtcatggagcgctacaaaagcaaagtcaaatattggatgacattcaacgagatcaat
aaccaacgtaactggaaatatccactatttggttactgctgctctggagtggttttcact
gagcaagaaaatcctgaagaaacgatgtatcaggttctgcatcatcagtttgtcgccagt
gccaaagtagtcaaactgggccatgctattaatccggagtttaaaatcgggtgtatggtt
gcaatggtgccgctctatccattctcctgccatccagatgacatgatgtattcggtggag
gctatgcgtgagcgttatctattcggtgacgtccacatgcgtggttactacccttcatat
attctgaatgaatgggagcgccgcggtttcactatcaatatggaagagggcgaccttgat
actctacgtgagggctgcgccgattacatgggcttaagctattacatgagtaacgcagtt
tctgcggttaatcccggtagcggcaactccctttctggctttgagggcagtgtaccgaat
ccacatgttaaagcatccgattggggatggcagatcgatcccgtcggcttgcgttattca
ctgagcgtattgtatgaacgttaccagaagccgctgtttattgttgaaaatggttttggt
gctatcgacaaagtggctgatgacggtatggttcatgatgattaccgcattgcgtatctt
aaagcccatattgagcagatgaaaaaagcagtgtttgaagatggcgtagacctgatgggc
tacaccccctggggttgtatcgattgtgtatcattcacaaccggtgaatacagtaagcgt
tatggttttatctacgtggataaaaacgatgatggcaccggcaccatggcgcgttcacgt
aaacaaagttttgactggtataaaaaagtgattgccagcaatggtgaagagctttaa

DBGET integrated database retrieval system