KEGG   Yersinia enterocolitica subsp. palearctica Y11: Y11_05481Help
Entry
Y11_05481         CDS       T02010                                 

Definition
beta N-acetyl-glucosaminidase (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
yey  Yersinia enterocolitica subsp. palearctica Y11
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:yey00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Y11_05481
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    Y11_05481
Enzymes [BR:yey01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Y11_05481
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
584640..585653
Genome map
AA seq 337 aa AA seqDB search
MLDVASYELDAEEREILKHPLVGGLILFSRNFHDAEQLRELVRQIRAASHERLVVAVDQE
GGRVQRFRDGFTRLPAAQSFAAINDPATALQLAQDAGWLMAAEMISMDIDISFAPVLDIG
HVSAAIGERSFHSDPQQALKMAECFIRGMHSAGMKTTGKHFPGHGAVTADSHKETPRDNR
PLAEIRTHDMVIFRELIARRLLDAIMPAHVIYTEADACPASGSSYWLQTILRQELGFDGI
IFSDDLSMEGAAIMGSYAERGQASLDAGCDMILVCNNRQGAVSVLDNLSSVKADQLACLY
HSGQFDRQALMASPRWQQANKALTALSERWDAHKSRG
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgttagacgttgccagctatgagctggatgcagaagaacgtgagattttaaagcacccg
ctggtgggcggactgattttattcagccgtaattttcatgatgccgagcaactacgcgag
ttagtccgccagataagggcggcatcccatgagcgcttagtggtggcggttgatcaggaa
ggggggcgcgtacagcgtttccgtgatggttttacccgcttacctgcggctcagtcgttc
gcggcgatcaatgatccagccactgcgttgcagttagcacaagatgcgggctggctgatg
gcggccgaaatgatatcaatggatatcgatattagctttgcgccagtactggatattggc
catgtcagcgcggctatcggtgagcgttcattccacagtgacccgcaacaagcactgaaa
atggcagagtgttttattcgtgggatgcacagcgcaggtatgaaaaccaccggtaagcac
ttccccgggcatggggcggtgacggcagattcacataaagagacgcctcgggataatcga
ccactggcagaaatccgcactcatgatatggttatatttcgcgaactgattgcgcggcga
ttactggatgccattatgcctgctcatgtgatttatactgaagctgatgcgtgtccagcc
agtggttcgtcttactggctgcaaaccatattacgccaagagttagggttcgatggcatc
attttctctgatgacttgtcgatggaaggggctgccatcatgggcagttatgccgagcgt
gggcaagcctctttggatgcaggctgcgatatgattttagtgtgtaataaccgtcagggc
gcggtaagtgtgttggataatctgtcgtcagtcaaagcagaccaactggcatgcttgtat
cattctgggcagtttgaccgtcaggcgttgatggcatcaccgcgttggcaacaggcgaat
aaggcattaacagcactcagcgaacgttgggatgcacataagtcgcgaggataa

DBGET integrated database retrieval system