KEGG   Yersinia enterocolitica subsp. palearctica Y11: Y11_07961Help
Entry
Y11_07961         CDS       T02010                                 

Definition
glutathione peroxidase (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
yey  Yersinia enterocolitica subsp. palearctica Y11
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:yey00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:yey00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
820424..820897
Genome map
AA seq 157 aa AA seqDB search
MLVVNVASQCGLTKQYEGLENLYKTYQQQGFEVLGFPSNEFAGQEPGSDEEIQAFCRGTF
GVDFPMFSKIEVNGPQRHPLYQHLIAAKPVAVKPEGSEFYQRLASKGREPKHAGDILWNF
EKFLIGRDGTVLERFAPDMTPEDPILVNAITRALATH
NT seq 474 nt NT seq  +upstreamnt  +downstreamnt
ttgctggtggtcaatgtggcttcccaatgtggtttaaccaagcagtatgaagggttggaa
aatctatacaaaacatatcagcaacagggttttgaagtattgggctttccaagcaatgag
tttgcgggtcaagagcccggcagcgatgaggaaatccaggcattttgtcgtggaactttt
ggtgtcgatttcccgatgttcagcaaaatagaagttaatggcccacaacggcatccttta
taccaacatctaatcgcggccaaacctgtggcggtaaaacctgaaggtagtgagttctat
cagcgcttagcaagtaaaggtcgtgagccaaaacatgccggtgacattctgtggaacttt
gaaaaattcttgattggccgagatggtacggttcttgaaagatttgcacccgatatgacg
ccagaagacccgattttggtcaatgctattacacgcgcattggctactcactaa

DBGET integrated database retrieval system