KEGG   Yersinia enterocolitica subsp. palearctica Y11: Y11_07961Help
Entry
Y11_07961         CDS       T02010                                 

Definition
glutathione peroxidase (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
yey  Yersinia enterocolitica subsp. palearctica Y11
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:yey00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Y11_07961
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Y11_07961
Enzymes [BR:yey01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Y11_07961
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
820424..820897
Genome map
AA seq 157 aa AA seqDB search
MLVVNVASQCGLTKQYEGLENLYKTYQQQGFEVLGFPSNEFAGQEPGSDEEIQAFCRGTF
GVDFPMFSKIEVNGPQRHPLYQHLIAAKPVAVKPEGSEFYQRLASKGREPKHAGDILWNF
EKFLIGRDGTVLERFAPDMTPEDPILVNAITRALATH
NT seq 474 nt NT seq  +upstreamnt  +downstreamnt
ttgctggtggtcaatgtggcttcccaatgtggtttaaccaagcagtatgaagggttggaa
aatctatacaaaacatatcagcaacagggttttgaagtattgggctttccaagcaatgag
tttgcgggtcaagagcccggcagcgatgaggaaatccaggcattttgtcgtggaactttt
ggtgtcgatttcccgatgttcagcaaaatagaagttaatggcccacaacggcatccttta
taccaacatctaatcgcggccaaacctgtggcggtaaaacctgaaggtagtgagttctat
cagcgcttagcaagtaaaggtcgtgagccaaaacatgccggtgacattctgtggaacttt
gaaaaattcttgattggccgagatggtacggttcttgaaagatttgcacccgatatgacg
ccagaagacccgattttggtcaatgctattacacgcgcattggctactcactaa

DBGET integrated database retrieval system