KEGG   Yersinia enterocolitica subsp. palearctica Y11: Y11_09191Help
Entry
Y11_09191         CDS       T02010                                 

Definition
alkaline phosphatase (EC:3.1.3.1)
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
yey  Yersinia enterocolitica subsp. palearctica Y11
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:yey00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Y11_09191
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    Y11_09191
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Y11_09191
Enzymes [BR:yey01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     Y11_09191
Exosome [BR:yey04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Y11_09191
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
951469..952899
Genome map
AA seq 476 aa AA seqDB search
MQNRVSTLSGIALSTLILSSSLFAPNAIAAATGLYDRSAHGDVTQFGGARRLTEDQTQAL
RDSLSNKTVKNVILLIGDGMGDSEITSARNYGMGAGGFFKAIDALPLTGQYTHYSLDKKT
QKPDYVTDSAASATAWSSGVKTYNGALGVDVFGKDHVTLLELAKKAGKATGNVSTAELQD
ATPAAQFAHVTGRKCYGPEETSEKCSTNALENGGRGSITEQMIEGRADVTLGGGSKSFSQ
LAKAGEWKDKSLRDQALARGYVIVENLDDLNAIKQADQQKPLLGLFSSGNMPVRWQGPKA
SYHGNIDKPPVVCENNAERTQGTPTLAAMTEKAIDLLKTNKNGFFLQVEGASIDKQDHAA
NPCGQFGETVDLDEAVQKALEFARADGNTLVIVTADHAHSSQIIEADAKSPGLTQALTTK
DGAIMAISYGNSEDDSQGHTGTQLRIAAYGPHAANVVGLTDQTDLFFTMRDAMAIK
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgcagaaccgcgtatccactttgtccggcatagcgttatccaccctgatactgagcagc
tctctgttcgcccccaatgctattgccgccgccaccggtttatacgatcgcagcgcccac
ggtgatgtcactcaatttggtggtgctcgccgtttaactgaagaccaaactcaggctctt
cgtgattcgctgtccaacaaaacggtaaaaaatgtcattttactgattggcgatgggatg
ggtgactcagagataacctcggcacgtaactatggcatgggcgcgggtggtttcttcaaa
gcgattgatgcattgccgctgaccggacaatacacgcactattcattagataagaaaaca
cagaaaccagattatgtgactgactcggccgcgtcggctactgcatggtcttcaggtgta
aaaacctataatggcgctctgggtgtcgatgtgttcgggaaagatcacgtcaccttgttg
gaattggctaaaaaagcaggtaaagcgactggcaacgtttcaacagctgaactgcaagat
gcaacgcctgcggcacaatttgctcatgttactggtcgcaaatgttacggcccggaagaa
accagtgagaagtgcagtactaatgcgttggagaatggaggtcgtggttccatcacggag
caaatgattgaagggcgcgccgatgtcaccttgggcggcggctcaaagtcattcagccag
ttggctaaagcgggtgaatggaaagataaatctttgcgtgatcaggcactggctcgtggt
tatgtgattgtcgaaaacctggatgatttgaatgccatcaaacaagcagaccaacaaaaa
ccactgttggggttattcagttctggcaacatgccggtacgttggcaggggccaaaagcc
tcttatcacggcaatatagataagccgcctgtggtttgtgaaaacaatgctgagcgaact
cagggtacgccaaccttggccgccatgaccgaaaaagccattgacctactcaaaaccaac
aaaaatggcttcttcttacaagtcgaaggggcgtcaatcgataaacaagatcacgctgct
aacccttgcggccagtttggcgaaaccgtcgatttggacgaagcagtacaaaaagcattg
gaatttgcccgcgcagatggcaacactctggttatcgtgaccgcagaccatgctcattcc
agtcaaattattgaggctgatgccaaatctccgggcctgacccaagctctaactaccaaa
gatggtgcaataatggctatcagttatggcaactcagaagatgattcccaagggcatacc
ggtacacaattgcgcattgccgcttacggcccacatgctgcgaatgttgttggtctgaca
gaccaaactgacctgttctttaccatgcgcgatgccatggcgattaaataa

DBGET integrated database retrieval system