KEGG   Yersinia enterocolitica subsp. palearctica Y11: Y11_10791Help
Entry
Y11_10791         CDS       T02010                                 

Definition
tryptophan synthase beta chain (EC:4.2.1.20)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
yey  Yersinia enterocolitica subsp. palearctica Y11
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:yey01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:yey00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:yey00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1102712..1103902
Genome map
AA seq 396 aa AA seqDB search
MTTLNPYFGEFGGMYVPQILMPALKQLEEAFVSAQLDPAFQAEFQDLLKNYAGRPTALTL
CQNLTEGTKTKLYLKREDLLHGGAHKTNQVLGQALLAKRMGKTEIIAETGAGQHGVASAL
ACALLGLKCRIYMGAKDIERQSPNVFRMRLMGAEVIPVHSGSSTLKDACNEALRDWSGSY
ETAHYMLGTAAGPHPYPTIVREFQRMIGEETKVQLLAREGRLPDTVLACIGGGSNAIGMF
ADFIDEPGVGLIGVEPAGLGIETGQHGAPLKHGKVGIYFGMKSPMMQTSDGQIEESYSIS
AGLDFPSVGPQHAYLNSIGRADYVSVTDDEALDAFKALSCKEGIIPALESSHALAHALKM
IKAEPEKEQILVVNLSGRGDKDIFTVHDILKARGEI
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgaccacattaaatccttactttggcgagttcgggggaatgtatgtaccccagattctg
atgccagcattgaaacaactggaagaagcttttgttagtgcacaactggatcctgcattt
caggcggaatttcaggatttattaaagaactatgctgggcgtccaaccgctctgaccctg
tgtcaaaatctgaccgagggaaccaaaaccaagttatatctgaaacgtgaagacttgtta
cacggtggcgcgcacaagactaatcaggttttaggccaggctttattagccaagcgcatg
ggtaaaacagaaatcattgctgaaactggtgcgggtcagcatggtgtagcttcagcatta
gcctgtgccctattgggcttaaaatgtcgtatctatatgggtgccaaagacattgagcgt
cagtcgccaaacgttttccgtatgcgcctgatgggggctgaagttatcccggttcacagc
ggttcatcaacgctgaaagatgcgtgtaatgaagccctgcgtgattggtctggaagctac
gaaaccgcccactatatgctgggaactgccgcaggcccgcacccttaccccactattgtg
cgtgaattccagcgtatgattggcgaagaaaccaaagtgcaactgttggcccgagaaggc
cgcctgcccgatacggtgctggcatgcatcggtggcggttctaacgccattggcatgttt
gctgactttatcgatgagccgggtgtagggctgattggcgtggaaccggctgggttgggt
atcgaaaccggtcaacatggtgctccactaaaacatggcaaagtgggtatctacttcggt
atgaaatcaccgatgatgcaaaccagtgatggtcaaattgaagaatcttactcaatttct
gccggtttagacttcccatctgtcgggccacaacatgcttatttgaatagcatcggacgc
gctgattatgtatcagtgactgatgatgaagctctggatgcgtttaaagcgctgtcatgc
aaagaagggatcattccggcgttggagtcttcccatgcattggcccatgccctgaaaatg
attaaagcagagccggaaaaagaacagatattggtggtgaatttgtccgggcggggtgat
aaagatattttcacagttcacgatattctgaaagcgcggggagaaatttaa

DBGET integrated database retrieval system