KEGG   Yersinia enterocolitica subsp. palearctica Y11: Y11_10801Help
Entry
Y11_10801         CDS       T02010                                 

Definition
(GenBank) tryptophan synthase alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
yey  Yersinia enterocolitica subsp. palearctica Y11
Pathway
yey00260  Glycine, serine and threonine metabolism
yey00400  Phenylalanine, tyrosine and tryptophan biosynthesis
yey01100  Metabolic pathways
yey01110  Biosynthesis of secondary metabolites
yey01130  Biosynthesis of antibiotics
yey01230  Biosynthesis of amino acids
Module
yey_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:yey00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Y11_10801
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Y11_10801
Enzymes [BR:yey01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Y11_10801
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA NMO His_biosynth
Motif
Other DBs
NCBI-ProteinID: CBY27101
UniProt: A0A0H3NPJ9
Position
1103902..1104708
Genome map
AA seq 268 aa AA seqDB search
MERYQQLFKQLAAKKEGAFVPFVQLGDPTPALSLEIIDTLITAGADALELGIPFSDPLAD
GPTIQNAALRAFAAGVTPSICFEMLAEIRKKHPTIPIGLLMYANLVFHNGIDTFYQRCAD
VGVDSVLIADVPFEESLPFRTAALRHGIAPIFICPPNADDDLLREIASHGRGYTYLLSRA
GVTGAENHGQLPLNHLIDKLCEYNAAPALQGFGISEPEQVKISLAAGAAGAISGSAIVKI
IENNVSQPAEMLAQLANFVTNMKAATRS
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atggagcgttatcaacagcttttcaaacagttggctgccaaaaaagaaggcgcatttgta
cctttcgtgcaactcggcgacccaacaccggctctctccttagaaattatcgacactttg
attaccgcaggtgctgatgcattggagttgggcattcctttctctgatccattggctgat
ggcccgacgattcaaaacgccgcactacgtgctttcgccgctggtgttaccccaagtatc
tgttttgagatgctggcagaaatccgtaaaaagcaccctaccattcccattgggttgctg
atgtatgcaaatctggtattccataacgggatagatactttctaccagcgctgcgctgat
gtcggtgtcgactcggtgctgattgctgatgtaccgtttgaagagtccctaccattccgt
actgcggccttacgccacgggattgcgcctatctttatctgcccgcctaatgcagatgat
gatttattgcgagaaatagcctctcatggccgtggctatacctacctgctctcccgcgcg
ggtgtgacgggggctgaaaatcacggacagctgccattgaatcatttgatagataaattg
tgtgaatacaatgcggctccagctctacaaggttttggtatctcagaacctgaacaggta
aaaatcagtctggcagctggggcagcaggtgccatttcaggttctgctattgtaaaaatc
attgaaaacaatgtctcacagcccgcagagatgctcgcgcaattagccaacttcgtgacc
aatatgaaagcagccacccgcagctag

DBGET integrated database retrieval system