KEGG   Yersinia enterocolitica subsp. palearctica Y11: Y11_11021Help
Entry
Y11_11021         CDS       T02010                                 

Definition
alcohol dehydrogenase; Acetaldehyde dehydrogenase (EC:1.1.1.1 1.2.1.10)
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
yey  Yersinia enterocolitica subsp. palearctica Y11
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:yey00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Y11_11021
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Y11_11021
   00620 Pyruvate metabolism
    Y11_11021
   00650 Butanoate metabolism
    Y11_11021
  Lipid metabolism
   00071 Fatty acid degradation
    Y11_11021
  Amino acid metabolism
   00350 Tyrosine metabolism
    Y11_11021
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Y11_11021
   00626 Naphthalene degradation
    Y11_11021
Enzymes [BR:yey01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Y11_11021
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Y11_11021
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1126064..1128739
Genome map
AA seq 891 aa AA seqDB search
MAVTNVAELNELVARVKKAQREYANFTQEQVDKIFRAAALAAADARIPLAKLAVEESGMG
IVEDKVIKNHFASEYIYNAYKDEKTCGILEEDKTFGTITIAEPIGLICGIVPTTNPTSTA
IFKALISLKTRNGIVFSPHPRAKDATNKAADIVLQAAIAAGAPADIIGWIDAPTVELSNQ
LMHHPDINLILATGGPGMVKAAYSSGKPAIGVGAGNTPVVVDETADIKRVVASILMSKTF
DNGVICASEQSIIVVDSVYDAVRERFASHGGYLLQGKELKAVQDIILKNGGLNAAIVGQP
ATKIAEMAGIKVPANTKILIGEVKVVDESEPFAHEKLSPTLAMYRAKSFEDAVEKAEKLV
EMGGIGHTSCLYTDQDNQPARVKYFGDKMKTARILINTPASHGGIGDLYNFKVAPSLTLG
CGSWGGNSISENVGPKHLINKKTVAKRAENMLWHKLPKSIYFRRGSLPIALEEVATDGAK
RAFIVTDRYLFNNGYADQITSVLKSHGIETEVFFEVEADPTLSIVRKGAEQMNSFKPDVI
IALGGGSPMDAAKIMWVMYEHPETHFEELALRFMDIRKRIYKFPKMGVKAKMIAVTTTSG
TGSEVTPFAVVTDDATGQKYPLADYALTPDMAIVDANLVMNMPKSLCAFGGLDAVTHALE
AYVSVLANEYSDGQALQALKLLKEFLPASYHEGAKNPVARERVHNAATIAGIAFANAFLG
VCHSMAHKLGSEFHIPHGLANAMLISNVIRYNANDNPTKQTAFSQYDRPQARRRYAEIAD
HLGLSAPGDRTAQKIQKLLAWLDEIKADLGIPASIREAGVQEADFLAKVDKLSEDAFDDQ
CTGANPRYPLISELKQILMDTYYGREFSEELDREEVAVATPAAKAEKKAKK
NT seq 2676 nt NT seq  +upstreamnt  +downstreamnt
atggctgtaacgaatgtcgctgaacttaacgagctagtagcacgcgtcaagaaagcccag
cgcgagtatgccaacttcactcaagagcaggttgataaaatcttccgcgccgcagctttg
gctgctgcagatgcccgtattcctctggctaaattagctgtagaagagtcaggcatgggt
attgtggaagacaaagtgatcaaaaaccactttgcttctgaatacatttacaatgcttac
aaagatgaaaagacttgtggcattctggaagaagataaaacctttggtactatcaccatc
gctgaacctatcggtttgatttgcggtatcgtgccaacgaccaacccaacctctactgct
atcttcaaggcgttaattagcctgaagacccgtaacggtatcgtattctctccacatcct
cgtgcaaaagacgcaaccaataaagccgcagatatcgtgcttcaagccgctatcgcagca
ggtgcgccagccgatatcattggttggattgatgcccctacagttgagttatctaaccaa
ctgatgcatcatccagacattaacctgattctggcgaccggtggtccaggcatggttaaa
gcagcttacagttctggtaagccagctatcggtgttggtgcaggtaacacacccgttgtt
gttgatgaaacagcagatatcaaacgtgttgtcgcctctattctgatgtctaaaaccttt
gataacggcgtaatctgtgcgtcagagcagtctatcatcgtcgttgactctgtttatgat
gctgtccgtgagcgcttcgcttcacacggtggctacctgttacaaggcaaagaactgaaa
gctgttcaggatatcatcctgaaaaatggtggcctgaacgccgctatcgtgggtcagcca
gccactaaaattgctgaaatggccggcattaaagttcccgctaataccaagattcttatc
ggcgaagtgaaagttgttgatgaatcagagccattcgctcacgaaaaactgtctcctact
ttggcgatgtatcgtgcgaagagcttcgaagacgcagttgaaaaagcagaaaaactggtg
gaaatgggcggtatcggccatacatcttgcctgtatacagaccaggataatcagccagcg
cgcgttaagtatttcggcgataaaatgaaaaccgcccgaatcttaatcaacacgcctgcc
tctcatggtggtatcggtgacctgtataacttcaaagtagcgccgtctctgacgctgggt
tgcggttcttggggtggtaactccatctctgaaaacgtcggtccgaaacacttgatcaac
aaaaaaactgtggctaagcgagcagaaaacatgttgtggcataaactcccgaaatctatt
tacttccgccgtggctccctgcctatcgcgttggaagaagtggcaactgacggtgcaaaa
cgtgccttcatcgtgactgaccgctacctgttcaacaacggttatgccgatcaaatcacc
agcgtactaaaatctcacggtatcgaaactgaagtcttcttcgaagtagaagcagaccct
accctgagcatcgtacgtaaaggtgcagagcagatgaactccttcaaaccagacgtgatc
atcgcgctgggtggtggttcaccgatggatgctgccaaaatcatgtgggtgatgtacgaa
catcctgaaactcacttcgaagaactggcattgcgctttatggatatccgtaaacgtatt
tacaagttcccgaaaatgggcgtgaaagcgaaaatgatcgccgtcacaaccacatcaggt
accggttcagaagtcacaccattcgccgtagttaccgacgatgcgacaggccagaaatat
ccattggctgactatgcattgacaccagatatggcaatcgttgatgccaacctggttatg
aatatgcctaagtctctgtgtgccttcggtggtctggacgcagtgacccatgctctggaa
gcgtatgtttctgtattggcaaatgaatactctgacggtcaggctctgcaagcgctgaaa
ctgctgaaagaattcctgccagccagttatcacgaaggggcaaaaaatccggttgcacgt
gaacgcgttcacaacgccgcgaccattgccggtatcgcttttgctaacgccttcttgggt
gtctgtcactcaatggcccataaactgggttctgagttccacatcccacacggcctggca
aacgccatgttgatttctaacgttatccgctataacgcgaatgacaacccaaccaaacag
actgctttcagccagtatgaccgcccacaagcgcgtcgtcgctatgctgaaattgcagac
catctgggtctgagtgctccgggcgaccgtaccgcacagaaaatccagaaattgctggct
tggttagatgaaatcaaagctgatttgggcatcccagcgtcaattcgtgaagctggcgtt
caagaagcagacttcctggctaaagttgacaaattgtctgaagatgcattcgatgaccag
tgtacaggtgctaacccacgctacccactgatctccgagctgaaacagatcctgatggat
acttactacggccgtgaatttagcgaagagcttgaccgtgaagaagttgcagtagcaact
ccggcagcaaaagctgagaaaaaagctaaaaagtaa

DBGET integrated database retrieval system