KEGG   Yersinia enterocolitica subsp. palearctica Y11: Y11_11311Help
Entry
Y11_11311         CDS       T02010                                 

Definition
(GenBank) aldose 1-epimerase family protein YeaD
  KO
K01792  glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
yey  Yersinia enterocolitica subsp. palearctica Y11
Pathway
yey00010  Glycolysis / Gluconeogenesis
yey01100  Metabolic pathways
yey01110  Biosynthesis of secondary metabolites
yey01120  Microbial metabolism in diverse environments
yey01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:yey00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Y11_11311
Enzymes [BR:yey01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     Y11_11311
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: CBY27050
UniProt: A0A0H3NPF6
Position
1153421..1154299
Genome map
AA seq 292 aa AA seqDB search
MNEKVFTLPVVEQISPYISQRQLDELPIVVVSHPKVRAAVSLQGAHLLAFQPSGEQPIIW
LSNNTPFKEGIAIRGGVPICWPWFGPSAQPSHGFARLLPWKLSAHDENENGVILTFTLED
SDASRQFWPHPFTLIARFKLGEECEMELESHGEYEAVAALHTYFQIGNISQIKISGLGEK
YLDKVLKIADATQQGDLVFNGQTDRIYTHPETYSLIKDAALKRTIEVHHHHQSDVVAWNP
GAELSSSMVDMPNDGYKTMVCVETARVNKPLVAKQDSPARLAMTIRSRKNTQ
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgaacgagaaagtcttcaccctacctgttgttgaacaaatttcaccttatatcagccag
cgccagttggatgaactgccaatcgtagtggtttcccatccgaaggtacgtgccgccgtc
agcttgcaaggtgctcatttattggctttccaaccgagtggtgagcaaccgattatttgg
ttaagtaataacacaccatttaaagaaggtatcgctattcgtggtggtgtaccgatctgt
tggccttggtttggcccatcagcgcaaccttctcatggttttgctcgtttactgccatgg
aagctcagcgctcatgatgaaaatgagaatggggttatcttgaccttcactctggaagac
agcgatgcatctcgtcaattctggccacacccgttcactttgattgcccgcttcaagctg
ggcgaagaatgtgagatggaattagaatcacacggtgagtacgaggcagttgctgccttg
cacacttatttccagattggcaatatcagccagattaagatcagtggcctgggcgaaaag
taccttgataaagtgctgaaaattgctgatgcaacgcaacaaggtgacttggtctttaac
ggtcagactgaccgcatctatacccaccctgaaacctacagcctgataaaagatgccgcg
ctgaaacgtaccattgaagtgcatcaccatcatcaaagtgacgtagttgcgtggaatcca
ggagctgaactgtccagcagcatggttgatatgccaaatgatggatataaaacaatggtt
tgtgtagaaactgcgcgggtgaataaaccgttggttgccaaacaagattcccctgcacgt
ctggccatgactattcgtagtcgcaagaatacccaataa

DBGET integrated database retrieval system