KEGG   Yersinia enterocolitica subsp. palearctica Y11: Y11_11831Help
Entry
Y11_11831         CDS       T02010                                 

Definition
Holliday junction ATP-dependent DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
yey  Yersinia enterocolitica subsp. palearctica Y11
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:yey00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Y11_11831
Enzymes [BR:yey01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Y11_11831
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1207153..1207770)
Genome map
AA seq 205 aa AA seqDB search
MIGRLRGIILEKQPPLVLLETNGVGYEVQLPMTCFYELPDIGQEAIIFTQFVVREDAQLL
YGFNDKQERALFRELIKVNGVGPKLALAILSGMSAQQFVAAVEREDITTLVKLPGVGKKT
AERLVVEMKDRFKGLNGDLFNNTGDIQLPASNSSQISEADIEAEAASALVALGYKPQEAS
RLVSKIAKPGADCEALIRDALRAAL
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
gtgatagggcgcctcagaggtatcattctggaaaaacagccacccttggtgctgctggaa
actaacggtgttggctatgaagtccaactacctatgacctgtttttatgagctgccagat
attgggcaggaagccattatctttacccagtttgtggtacgtgaagatgctcagctacta
tacggttttaatgataagcaggaacgagcactgtttcgtgaattaataaaagtgaacggt
gtggggccaaaactggcgctggccattctttctggaatgtcggcgcaacagtttgtagcc
gcggttgaacgcgaagatattaccaccttggtaaaattaccgggggtcggcaagaagacc
gctgagcggttagtggttgaaatgaaagaccgctttaaaggcctcaatggtgacttgttt
aacaataccggtgatattcagttgcctgccagtaattcgtcacaaatctcagaagccgat
attgaagcggaagccgcttctgcgctggtagctttgggctataaaccacaagaagctagc
cgcctggtgagtaaaatagctaaaccgggtgcagattgtgaagctttgatccgtgatgct
ttgcgtgccgcgttatag

DBGET integrated database retrieval system