KEGG   Yersinia enterocolitica subsp. palearctica Y11: Y11_13311Help
Entry
Y11_13311         CDS       T02010                                 

Definition
prophage lysozyme; Phage lysin (EC:3.2.1.17)
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
yey  Yersinia enterocolitica subsp. palearctica Y11
Brite
Enzymes [BR:yey01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     Y11_13311
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1334686..1335192
Genome map
AA seq 168 aa AA seqDB search
MNSIVKRCLVGVILALAATLPNYQTLKTSAAGLKLIADYEGCQLNAYQCSANVWTNGIGH
TAGVKPGSVISERQVAVNLVADVQQVERAIAVCMPLVMPQPVYDAVVSFAFNVGTGAACR
STLAFFVNKGDWRSACNQLPRWVYVNGVKTKGLERRRTTEQTHCLSGV
NT seq 507 nt NT seq  +upstreamnt  +downstreamnt
atgaactcaatcgttaagcgctgtctggtcggggtcattctggcgctggccgccaccttg
ccaaactaccaaaccttaaaaacatcggccgccgggctaaaactgattgccgattatgag
ggctgccagctcaacgcctaccaatgcagcgccaacgtctggacaaatggcatcggtcac
accgccggagtgaagccgggcagcgttatcagtgagcgacaggtggcggtcaatctggtg
gctgacgtgcagcaggttgagcgggcaatagcggtgtgtatgccgcttgttatgccgcaa
ccggtgtatgacgcggtagtgtcgtttgcctttaacgtcggcaccggtgcggcctgccgc
tcgacgctggccttttttgtcaacaagggcgactggcgcagcgcctgcaatcagttgccg
cgctgggtgtatgtcaatggcgtgaaaaccaaagggttagagcgtcgccgcaccaccgaa
caaacacactgcctgagtggggtctga

DBGET integrated database retrieval system