KEGG   Yersinia enterocolitica subsp. palearctica Y11: Y11_13971Help
Entry
Y11_13971         CDS       T02010                                 

Definition
D-cysteine desulfhydrase (EC:4.4.1.15)
Orthology
K05396  
D-cysteine desulfhydrase [EC:4.4.1.15]
Organism
yey  Yersinia enterocolitica subsp. palearctica Y11
Pathway
Cysteine and methionine metabolism
Brite
KEGG Orthology (KO) [BR:yey00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Y11_13971
Enzymes [BR:yey01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.15  D-cysteine desulfhydrase
     Y11_13971
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1387764..1388756)
Genome map
AA seq 330 aa AA seqDB search
MTLQHKLAQFPRLDLVGNATPLEKLSRLSDYLGREIYIKRDDVTPLALGGNKLRKLEFLT
ADALRQGADTLVTAGAIQSNHVRQTAAVAAKLGLHCVALLENPIGTSQENYLTNGNRLLL
DLFNVEVVMCDGLHDPNRQLAELATRIEAQGFRPYVVPVGGSNALGALGYVQCALEIAAQ
SAGNVTFSSVVVASGSAGTHAGLAVGLQQLLPQTELIGVTVSRKAEEQRPKVTHIQQELA
TSLGVTSGPADITLWDDYFAPQYGMPNEEGLAAIGLLARLEGILLDPVYTGKAMAGLLDG
LEQKKFRDDGPILFIHTGGAPALFAYHPQV
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
gtgacgcttcaacataaactggcgcaatttccgcgcctggatttggtcggtaatgccacg
ccattagagaaactatctcgtctttctgactatttgggacgcgaaatctatattaaacgt
gatgatgtcacacccttggcacttggcggcaataagctgcgtaagctggagtttttaacg
gctgatgcgttgaggcaaggagcggatacactggtgaccgcaggggctatccaatctaat
catgtgcgccaaacagcggctgttgctgcaaaattgggcttacattgtgttgcgttactt
gagaatcctatcggtacctcacaggagaattatttgaccaatggcaatcgattgctgttg
gatttatttaatgttgaggtggtgatgtgcgatggattacatgatccaaaccggcaattg
gctgagttggcaacccgcatcgaggcgcagggatttcgcccttatgtggtgccggttggt
gggtctaatgctttaggggccttgggatatgtgcaatgtgcattggaaattgcagctcaa
tcggctggaaatgtcacctttagctcagtggttgtggcttcgggcagtgcgggtacccat
gcggggttggctgtcggtttacagcaactgttgccgcaaacggagctgattggtgtcaca
gtatcgcgcaaagcagaagaacagcgccctaaagttactcatattcaacaagaattagcg
acatccctcggcgtgaccagcgggcctgcggatatcaccctatgggatgattattttgcg
ccgcaatatggtatgccaaatgaagaagggctggcggcaatcgggttattggcaaggctg
gaaggaatattgctggacccggtttataccggcaaggcaatggctggtttacttgatggc
cttgagcagaaaaagtttcgcgatgatggccccattttgtttattcatactggcggcgca
cctgcattatttgcttatcatccgcaggtgtag

DBGET integrated database retrieval system