KEGG   Yersinia enterocolitica subsp. palearctica Y11: Y11_16531Help
Entry
Y11_16531         CDS       T02010                                 

Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
yey  Yersinia enterocolitica subsp. palearctica Y11
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:yey00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Y11_16531
  Amino acid metabolism
   00340 Histidine metabolism
    Y11_16531
Enzymes [BR:yey01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     Y11_16531
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1652498..1653823
Genome map
AA seq 441 aa AA seqDB search
MQPTNFNTLIDWQQCSEEQQKALLSRPAINASERITATVSEILDRVKAEGDSALRDFSQR
FDTVQVADIRISSDEIVAAAGRLNDDIKQAMAQAVRNIEIFHNAQKMPVVDVETQPGVRC
QQITRPIASVGLYIPGGSAPLLSTVLMLGTPARIAGCQRVILCSPPPIADEILYAAQLCG
IQEVFQIGGAQAIAAMAFGSESVPKVNKIFGPGNAYVTEAKRQVSQRLDGAAIDMPAGPS
EVLVIADSGATPAFIASDLLSQAEHGPDSQVVLLTPDAAIAQAVTVEVEQQLKQLSRADI
ARQALESSRLIITKDLQQCIDISNQYGPEHLILQIRQPEDIIDKIDNAGSVFMGDWSPES
AGDYASGTNHVLPTYGYTSTYSSLGLADFVKRMTVQQLTPQGLLGLASTIETLAQAEQLT
AHKNAVTLRVAALTAAQKEQA
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgcagccgacgaatttcaataccctaatcgactggcaacaatgcagcgaagagcaacaa
aaagcgctgttgagccgcccggctattaatgcttctgagcgaatcaccgcaacagtcagt
gaaatccttgaccgggtgaaagccgagggcgacagcgccttgcgtgattttagccaacgc
tttgataccgtgcaggtagctgatattcgcatcagtagcgatgaaatagtcgctgctgcc
gggcgtttgaatgacgacatcaagcaagctatggcgcaagcagtacgtaatattgaaatc
ttccacaacgcgcagaaaatgccagtggtggatgttgaaactcaaccgggcgtgcgttgc
cagcaaatcacccgcccgattgcttccgtcggcctgtatatccccggcggttctgctccg
ctactgtctaccgtcttgatgctcggcaccccagcgcgcattgccggttgccagcgcgtt
attttatgttctcctccgcctattgctgatgaaattctgtatgccgcgcaattgtgcggt
attcaggaagtgttccagattggtggcgcacaagcgattgctgcaatggcatttggcagc
gaatcagtgccgaaagtgaataaaatctttgggccgggcaatgcttacgtcacagaagca
aaacgtcaggtcagccaacgtttggacggtgccgcgatagatatgccagcgggcccatct
gaagtattggttatcgctgacagcggcgcgacaccggcatttattgcctcagacttgctg
tctcaggccgagcacggcccagactcacaagtggtattactgacaccagatgccgcgatt
gctcaggccgttacggtcgaagttgagcaacaacttaagcagttgtcgcgcgctgacatt
gcccgacaggcactggaaagtagccgtttgatcatcaccaaagatttgcagcaatgtatt
gatataagtaatcaatacgggccagagcacttgattctgcaaatacgccagccggaagat
attatcgataagattgataatgccggctcagtgtttatgggggactggtcgccagaatca
gcgggtgactatgcctctggcaccaatcacgtattaccgacttatggttacacctcaacc
tattccagtttgggactggctgattttgttaagcgtatgaccgtgcagcaattaaccccg
caaggcttgctgggtctggcatcaaccatcgaaacgctggctcaggctgaacaactgacc
gcccacaaaaacgccgttaccctacgcgtcgctgccctaacagccgcccaaaaggagcaa
gcatga

DBGET integrated database retrieval system