KEGG   Yersinia enterocolitica subsp. palearctica Y11: Y11_16631Help
Entry
Y11_16631         CDS       T02010                                 

Definition
UTP--glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
yey  Yersinia enterocolitica subsp. palearctica Y11
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:yey00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Y11_16631
   00052 Galactose metabolism
    Y11_16631
   00500 Starch and sucrose metabolism
    Y11_16631
   00520 Amino sugar and nucleotide sugar metabolism
    Y11_16631
Enzymes [BR:yey01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Y11_16631
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1661582..1662472)
Genome map
AA seq 296 aa AA seqDB search
MKSLKAVIPVAGLGTRMLPATKAIPKEMLPVVDKPLIQYIVNECVAAGVKEIVLVSHSSK
NAIENHFDTSFELEAALESRVKRQLLKEIKSICPQDVTIMQVRQGHAKGLGHAVLCAQPM
VGDNPFIVLLPDVLLDDSTADLSKENLASMIKRFEETGRSQIMVEPVPQADVSKYGIADC
GHVDLAPGESTLMTAVVEKPSVEDAPSNLAVVGRYVLSKDIWPLLKKTPRGAGDEIQLTD
AIAMLMEQEPVEAFHMTGKSHDCGDKLGYMKAFVTYGVRHSTEGENFTAWLKQQID
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgaagtctttgaaagcagtcattcctgttgccgggcttggcacccgcatgttgccagcg
accaaggcgattccgaaagaaatgctgccagtagtcgataagcccctgattcaatatatt
gttaatgaatgtgttgctgccggggtcaaagagatcgtactggtgagccactcttccaag
aacgcaatagaaaaccattttgatacttcatttgaacttgaagcggccttggagtctcgg
gttaagcggcagttattaaaagagattaagagtatttgcccgcaagatgtcactatcatg
caagtgcgtcaaggtcacgccaaagggttagggcatgcggtactgtgtgctcaaccgatg
gtgggtgacaatccttttattgtattgctgccagatgtattactcgatgattcaacagct
gatttgtcgaaagagaatcttgccagcatgattaaacgttttgaagaaaccgggcggagc
cagatcatggtggaaccggtacctcaagcagatgtttccaagtacggtattgctgattgc
ggccatgtcgatttagcgccgggtgaaagtactcttatgactgcggtggtagagaagcct
tctgtggaggacgcgccgtctaatcttgctgtggttgggcgctacgttttgtctaaagat
atttggccgttgctgaagaaaactccgcgcggtgctggtgatgaaattcaactaactgat
gctatcgcgatgttaatggagcaagagccggttgaagctttccatatgacgggtaaatct
catgattgcggagataaattaggctatatgaaagcctttgtgacttatggtgttcgtcat
agtactgaaggtgaaaattttacagcttggctgaaacagcaaattgactaa

DBGET integrated database retrieval system