KEGG   Yersinia enterocolitica subsp. palearctica Y11: Y11_17211Help
Entry
Y11_17211         CDS       T02010                                 

Definition
(GenBank) GTP cyclohydrolase I type 1
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
yey  Yersinia enterocolitica subsp. palearctica Y11
Pathway
yey00790  Folate biosynthesis
yey01100  Metabolic pathways
Module
yey_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:yey00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Y11_17211
Enzymes [BR:yey01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Y11_17211
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI QueF
Motif
Other DBs
NCBI-ProteinID: CBY26460
UniProt: A0A0H3NT31
Position
complement(1727371..1728033)
Genome map
AA seq 220 aa AA seqDB search
MSSLSKEAELVHEALLARGLETPLRKQELDAETRKTRIQEHMTQVMQLLNLDLSDDSLAD
TPRRIAKMYVDEIFSGLDYENFPKITLIENKMKVDEMVTVRDITLTSTCEHHFVTIDGKA
TVAYIPKDSVIGLSKINRIVQFFAQRPQVQERLTQQILLALQTLLGTNNVAVSIDAVHYC
VKARGIRDATSATTTTSLGGLFKSSQNTRQEFLRAVRHNG
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgtcatcgctgagtaaagaagctgagctggttcatgaagcactgctggcccgtggcctt
gaaaccccattgcgcaaacaagaattagatgccgaaacgcgcaagacccggattcaggaa
catatgacgcaagtcatgcaattgttgaatcttgatttatctgacgatagcctggccgat
acaccaagacgcattgccaaaatgtatgttgatgagattttctctggattggattatgag
aatttccccaaaattaccctgatcgaaaataaaatgaaggtcgatgaaatggtaacggtg
cgagatatcaccctgaccagtacctgcgaacatcattttgtgacgattgatggtaaagcg
acagtggcctatatcccgaaagacagtgtgattggtttatccaaaattaaccgtatcgtg
cagtttttcgcccagcgcccacaagtacaagagcgactcacacagcaaattctgttggcg
ttgcagaccttgttagggacaaataatgtcgctgtctccatcgatgcagtacattattgt
gtgaaagctcgcgggatccgcgatgcgaccagtgcgaccaccactacatcattgggcggg
ttgttcaaatccagccagaatactcgtcaggagtttctgcgtgctgttcgtcacaacggc
taa

DBGET integrated database retrieval system