KEGG   Yersinia enterocolitica subsp. palearctica Y11: Y11_18401Help
Entry
Y11_18401         CDS       T02010                                 

Definition
(GenBank) phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
yey  Yersinia enterocolitica subsp. palearctica Y11
Pathway
yey00010  Glycolysis / Gluconeogenesis
yey00260  Glycine, serine and threonine metabolism
yey00680  Methane metabolism
yey01100  Metabolic pathways
yey01110  Biosynthesis of secondary metabolites
yey01120  Microbial metabolism in diverse environments
yey01130  Biosynthesis of antibiotics
yey01200  Carbon metabolism
yey01230  Biosynthesis of amino acids
Module
yey_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
yey_M00002  Glycolysis, core module involving three-carbon compounds
yey_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:yey00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Y11_18401
  Energy metabolism
   00680 Methane metabolism
    Y11_18401
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Y11_18401
Enzymes [BR:yey01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Y11_18401
Membrane trafficking [BR:yey04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    Y11_18401
Exosome [BR:yey04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Y11_18401
  Exosomal proteins of melanoma cells
   Y11_18401
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: CBY26341
UniProt: A0A0H3NYJ5
Position
1844948..1845700
Genome map
AA seq 250 aa AA seqDB search
MAVTKLVLVRHGESQWNNENRFTGWYDVDLSEKGRTEAKAAGKLLKDEGFTFDFAYTSVL
KRAIHTLWSILDELDQAWLPTEKTWKLNERHYGALQGLDKSETAAKYGDEQVKLWRRGFA
ITPPALDKSDERFPGHDPRYAKLTDAELPTTESLALTIDRVIPYWEEVIKPRIASGERVI
IAAHGNSLRALVKYLDNLNEEEILELNIPTGVPLVYEFDENFKPIKHYYLGNADEIAAKA
AAVANQGKAK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggcagtaacaaagctggttctggtacgtcacggcgaaagtcaatggaacaacgaaaac
cgtttcacaggttggtatgacgttgatttgtctgagaaaggccgtaccgaagcaaaagca
gctggcaagctgttgaaagatgaaggttttacttttgatttcgcctacacctcagtatta
aaacgcgctatccataccttgtggagcatcctggacgaactggatcaggcctggctccca
acggaaaaaacctggaaactgaatgagcgacattacggcgcattgcaaggtttggataaa
tctgaaactgcggctaaatacggtgatgagcaagttaaactgtggcgtcgcggctttgcc
atcacccctccagcactggataaaagtgatgagcgcttccctggccatgacccacgttat
gcaaaattaaccgatgcagagctgccaaccactgaaagcctggctctgactatcgatcgc
gttatcccttactgggaagaagtgatcaaaccacgcatcgccagtggcgagcgcgttatc
atcgctgctcacggtaactctttgcgtgcactggttaaatatctggataatctgaacgaa
gaagaaattcttgagctgaatatcccaacaggtgtgccattagtgtatgagtttgacgaa
aacttcaaaccaatcaaacactactatttgggcaacgctgatgaaatcgcggctaaagct
gctgcggttgccaatcagggtaaagcgaagtaa

DBGET integrated database retrieval system