KEGG   Yersinia enterocolitica subsp. palearctica Y11: Y11_18581Help
Entry
Y11_18581         CDS       T02010                                 

Definition
(GenBank) succinyl-CoA ligase [ADP-forming] beta chain
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
yey  Yersinia enterocolitica subsp. palearctica Y11
Pathway
yey00020  Citrate cycle (TCA cycle)
yey00640  Propanoate metabolism
yey00660  C5-Branched dibasic acid metabolism
yey01100  Metabolic pathways
yey01110  Biosynthesis of secondary metabolites
yey01120  Microbial metabolism in diverse environments
yey01130  Biosynthesis of antibiotics
yey01200  Carbon metabolism
Module
yey_M00009  Citrate cycle (TCA cycle, Krebs cycle)
yey_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:yey00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Y11_18581
   00640 Propanoate metabolism
    Y11_18581
   00660 C5-Branched dibasic acid metabolism
    Y11_18581
Enzymes [BR:yey01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Y11_18581
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A
Motif
Other DBs
NCBI-ProteinID: CBY26323
UniProt: A0A0H3NML5
Position
complement(1863444..1864610)
Genome map
AA seq 388 aa AA seqDB search
MNLHEYQAKQLFARYGMPAPTGYACTTPREAEEAASKIGAGPWVVKCQVHAGGRGKAGGV
KLVNSKEDIRAFAEQWLGKKLVTYQTDAHGQPVHQILVEAATDIDKELYLGAVIDRSSRR
VVFMASTEGGVEIEKVAEETPELIHKVALDPLTGPQPYQGRELAFKLGLTGKQVAQFTKI
FMGLATLFLERDLAMVEINPLVITKQGDLVCLDGKLGADGNALFRQPELREMRDKSQEDE
REAQAAQWELNYVALDGNIGCMVNGAGLAMGTMDIVKLHGGEPANFLDVGGGATKERVTE
AFKIILSDDKVKAVFVNIFGGIVRCDLIADGIIGAVEEVGVNVPVVVRLEGNNAELGAKK
LADSGLNIIAATSLTDAAQQVVAAVGAK
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaatttacacgaatatcaggcaaaacaactgtttgctcggtatggtatgccagcgcca
actggctacgcttgtaccacaccgcgtgaagcagaagaagccgcatctaaaatcggtgct
ggcccgtgggtggttaaatgtcaggtacatgctggtggtcgcggtaaagcgggcggcgtg
aaactggttaacagcaaagaagatattcgtgctttcgctgaacagtggttgggtaaaaag
ctggtcacttaccagacagatgcgcatggtcaaccggttcaccaaattttggttgaagca
gcgactgatatcgacaaagagctatatctgggtgcggttattgaccgtagctcccgtcgt
gtggtgtttatggcatccactgaaggcggcgttgaaattgaaaaagtggccgaagaaaca
ccagaactgatccataaggtcgcattggatccattgactggcccgcagccttatcaaggt
cgcgaattggcattcaaactgggtttaactgggaagcaagtggctcagttcaccaagatc
tttatgggtctggcgactttgttcctggaacgtgacttggcgatggttgagataaacccg
ctggttatcaccaaacagggtgatctggtttgtttggatggcaaactgggtgccgatggt
aacgctttgttccgtcaaccagaattacgtgaaatgcgtgataaatctcaggaagatgag
cgcgaagcacaggctgcacagtgggaactgaactatgtcgccttggatggcaacattggt
tgcatggtaaacggtgccggcttggcaatgggtactatggatattgtgaaactgcacggt
ggtgaaccagctaacttccttgatgtggggggcggtgccactaaagagcgcgtgactgaa
gcgttcaaaatcattttgtctgatgacaaagtgaaagcagttttcgttaatatcttcggc
ggtattgtgcgctgtgacctgattgctgacggcattattggtgcagttgaagaagtgggt
gtcaacgtgccagttgtagtgcgtttggaagggaataacgccgagctgggtgccaagaaa
ctggcagacagcggtttgaatatcattgctgcgaccagcctgacagatgcggctcagcaa
gttgtagcggcagtgggggctaaataa

DBGET integrated database retrieval system