KEGG   Yersinia enterocolitica subsp. palearctica Y11: Y11_18591Help
Entry
Y11_18591         CDS       T02010                                 

Definition
(GenBank) dihydrolipoamide succinyltransferase component (E2) of 2-oxoglutarate dehydrogenase complex
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
yey  Yersinia enterocolitica subsp. palearctica Y11
Pathway
yey00020  Citrate cycle (TCA cycle)
yey00310  Lysine degradation
yey01100  Metabolic pathways
yey01110  Biosynthesis of secondary metabolites
yey01120  Microbial metabolism in diverse environments
yey01130  Biosynthesis of antibiotics
yey01200  Carbon metabolism
Module
yey_M00009  Citrate cycle (TCA cycle, Krebs cycle)
yey_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:yey00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Y11_18591
  Amino acid metabolism
   00310 Lysine degradation
    Y11_18591
Enzymes [BR:yey01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Y11_18591
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2
Motif
Other DBs
NCBI-ProteinID: CBY26322
UniProt: A0A0H3NPI7
Position
complement(1864724..1865947)
Genome map
AA seq 407 aa AA seqDB search
MSSVDINVPDLPESVADGSVATWHKKPGDSVKRDEVLVEIETDKVILEVPASQDGILDAI
LEDEGATVTSRQVLGRIRPSDSSGLPTEEKSQSTESTPAQRQTASLEEESNDTLSPAIRR
LIAEHSLDASAIKGSGVGGRITREDIDNHLVTRKSAPAAVENKVEAAAPVAALAGRSEKR
VPMTRLRKRVAERLLEAKNSTAMLTTFNEINMKPIMDLRKQYGEAFEKRHGVRLGFMSFY
IKAVVEALKRYPEVNASIDGEDVVYHNYFDVSIAVSTPRGLVTPVLRDVDTMGMADIEKK
IKELAVKGCDGKLKVEELTGGNFTITNGGVFGSLMSTPIINPPQSAILGMHAIKDRPMAV
NGQVVILPMMYLALSYDHRLIDGRESVGYLVTVKEMLEDPARLLLDV
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atgagtagcgtagatattaatgttcctgacctccctgagtctgtcgccgatggctcggta
gcaacctggcacaaaaaaccgggtgatagcgtcaaacgcgatgaagtgctggttgagatt
gaaacagacaaagtgattctggaagttccggccagccaagacggtattttggatgccatt
ttggaagacgaaggtgccactgtgacttcgcgtcaagtgttgggccgtattcgtccaagt
gacagctctggcttgccgaccgaagaaaaaagccaaagcaccgagtccacccctgctcag
cgccaaaccgccagcctggaagaagaaagcaacgatactctcagcccggcgatccgtcgt
ctgattgcagaacactctcttgatgcttccgccattaaaggcagtggtgtgggtggtcgt
atcacgcgtgaagatattgataaccatttggtaacgcgtaaatcagcacctgctgccgtg
gaaaacaaagttgaagctgccgcaccggttgccgcacttgctggccgcagcgaaaaacgt
gttccgatgacgcgtctacgtaaacgtgttgccgagcgcctgctggaagctaaaaacagc
accgcaatgttgactacgtttaacgaaatcaacatgaagccaatcatggatctgcgcaag
cagtacggtgaggctttcgagaagcgtcacggtgtgcgtctgggctttatgtccttctat
atcaaggccgtggttgaagcgctgaaacgctatccagaagtgaatgcttctatcgatggc
gaagatgtggtttaccataattactttgatgtcagcattgccgtttctaccccacgcggc
ctggttacccctgtattacgtgatgtagatactatgggtatggctgatattgagaagaaa
atcaaagagctggctgtaaaaggctgtgacggcaaactgaaggttgaagaactgactggc
ggtaatttcactattaccaatggcggcgtattcggctcattgatgtcgaccccgatcatt
aacccaccacaaagcgcgatccttggtatgcatgctatcaaagacaggcctatggcggtc
aatggtcaggtagtgattctgccaatgatgtatctggcactgtcctacgaccaccggttg
atcgatggccgcgaatccgttggctatctggtgacggtgaaagagatgctggaagatcca
gctcgcttactgctggatgtataa

DBGET integrated database retrieval system