KEGG   Yersinia enterocolitica subsp. palearctica Y11: Y11_18591Help
Entry
Y11_18591         CDS       T02010                                 

Definition
dihydrolipoamide succinyltransferase component (E2) of 2-oxoglutarate dehydrogenase complex (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
yey  Yersinia enterocolitica subsp. palearctica Y11
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:yey00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Y11_18591
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Y11_18591
  Amino acid metabolism
   00310 Lysine degradation
    Y11_18591
Enzymes [BR:yey01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Y11_18591
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1864724..1865947)
Genome map
AA seq 407 aa AA seqDB search
MSSVDINVPDLPESVADGSVATWHKKPGDSVKRDEVLVEIETDKVILEVPASQDGILDAI
LEDEGATVTSRQVLGRIRPSDSSGLPTEEKSQSTESTPAQRQTASLEEESNDTLSPAIRR
LIAEHSLDASAIKGSGVGGRITREDIDNHLVTRKSAPAAVENKVEAAAPVAALAGRSEKR
VPMTRLRKRVAERLLEAKNSTAMLTTFNEINMKPIMDLRKQYGEAFEKRHGVRLGFMSFY
IKAVVEALKRYPEVNASIDGEDVVYHNYFDVSIAVSTPRGLVTPVLRDVDTMGMADIEKK
IKELAVKGCDGKLKVEELTGGNFTITNGGVFGSLMSTPIINPPQSAILGMHAIKDRPMAV
NGQVVILPMMYLALSYDHRLIDGRESVGYLVTVKEMLEDPARLLLDV
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atgagtagcgtagatattaatgttcctgacctccctgagtctgtcgccgatggctcggta
gcaacctggcacaaaaaaccgggtgatagcgtcaaacgcgatgaagtgctggttgagatt
gaaacagacaaagtgattctggaagttccggccagccaagacggtattttggatgccatt
ttggaagacgaaggtgccactgtgacttcgcgtcaagtgttgggccgtattcgtccaagt
gacagctctggcttgccgaccgaagaaaaaagccaaagcaccgagtccacccctgctcag
cgccaaaccgccagcctggaagaagaaagcaacgatactctcagcccggcgatccgtcgt
ctgattgcagaacactctcttgatgcttccgccattaaaggcagtggtgtgggtggtcgt
atcacgcgtgaagatattgataaccatttggtaacgcgtaaatcagcacctgctgccgtg
gaaaacaaagttgaagctgccgcaccggttgccgcacttgctggccgcagcgaaaaacgt
gttccgatgacgcgtctacgtaaacgtgttgccgagcgcctgctggaagctaaaaacagc
accgcaatgttgactacgtttaacgaaatcaacatgaagccaatcatggatctgcgcaag
cagtacggtgaggctttcgagaagcgtcacggtgtgcgtctgggctttatgtccttctat
atcaaggccgtggttgaagcgctgaaacgctatccagaagtgaatgcttctatcgatggc
gaagatgtggtttaccataattactttgatgtcagcattgccgtttctaccccacgcggc
ctggttacccctgtattacgtgatgtagatactatgggtatggctgatattgagaagaaa
atcaaagagctggctgtaaaaggctgtgacggcaaactgaaggttgaagaactgactggc
ggtaatttcactattaccaatggcggcgtattcggctcattgatgtcgaccccgatcatt
aacccaccacaaagcgcgatccttggtatgcatgctatcaaagacaggcctatggcggtc
aatggtcaggtagtgattctgccaatgatgtatctggcactgtcctacgaccaccggttg
atcgatggccgcgaatccgttggctatctggtgacggtgaaagagatgctggaagatcca
gctcgcttactgctggatgtataa

DBGET integrated database retrieval system