KEGG   Yersinia enterocolitica subsp. palearctica Y11: Y11_18631Help
Entry
Y11_18631         CDS       T02010                                 

Definition
succinate dehydrogenase hydrophobic membrane anchor protein
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
yey  Yersinia enterocolitica subsp. palearctica Y11
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:yey00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Y11_18631
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Y11_18631
   00650 Butanoate metabolism
    Y11_18631
  Energy metabolism
   00190 Oxidative phosphorylation
    Y11_18631
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1871594..1871941)
Genome map
AA seq 115 aa AA seqDB search
MVSNASALGRNGVHDWLLLRASAIVITLYILYILGFVVIVPDITYEIWRGFFASHITKVF
TLLTLLSILAHAWIGLWQVLTDYIKPLAVRLVLQLAVVITLLVYLLYGTIVVWGA
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atggtaagcaatgcttctgcgttagggcgtaatggagtacacgactggctgttactgcgt
gcttctgcaatcgtcatcactctatatattctttatattctgggcttcgttgttattgtc
ccagacatcacctacgaaatctggcgtggcttctttgcttcgcacatcacaaaagtattt
accctgctgacattgctgtcgattctggctcatgcctggattggtctatggcaggtatta
acggactatatcaagccgctagcggtacgactggtgttacaactggccgtggtgattacg
ctgctggtctacctcttgtatggaacaattgtggtgtggggtgcttaa

DBGET integrated database retrieval system