KEGG   Yersinia enterocolitica subsp. palearctica Y11: Y11_18941Help
Entry
Y11_18941         CDS       T02010                                 

Definition
beta-hexosaminidase (EC:3.2.1.52)
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
yey  Yersinia enterocolitica subsp. palearctica Y11
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:yey00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Y11_18941
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Y11_18941
Enzymes [BR:yey01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Y11_18941
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1913337..1916012)
Genome map
AA seq 891 aa AA seqDB search
MNKFRLNALAAITATFGLMGAAHADATNQQIVDQLSALKVNYKVLDNRAAENGVDCAKLG
ADWASCNKVVITLTNTGDEIKGQDWAIYFHSIRQILTVDNDQFKITHLTGDLHKIEPTAK
FTGFPANQAVEIPITGEYWQLFATDFMPRWYATSGDAKPKVLKSTDTEDINEYLTQFTGD
QWKRTKDDNNVLMTPESRFVKNETVKTLTAANLRGQIIPTPMEVKVHQQDADLSQGVALD
LSTLPKPAAEAAEQRFALLGLKLGSTGFPIKTLIQPSAFKGDLAVSGAYELKIGEKGAQV
IGFDPTGVFYGLQSILSLVPTDGSKKIATLDAKDAPRFEYRGVFLDVGRNFKTKDAVLRL
LDQMAAYKLNKFHFHLSDDEGWRIEIPGLPELTDVGSKRCHDLTENTCLLPQLGSGPDSN
NLGSGHFTRDDYIDILKYAKARQIEVIPEIDMPAHARAAVVSMEARYNNLMKQGKEKEAN
EFRLVDPTDDSNTTSVQFYERKSYLNPCLDSSKRFVDKVIGEMAQMHKEAGMPLNTWHFG
GDEAKNIRLGAGFQDKNGTIEPGKGIIDKSIEDKPWAKSQVCQDMVKQGKIQDVEHLSSH
FAIEVSKLVNAHGIEKMQAWQDGLKDAKSSKDFATKRVGVNFWDTLYWGGADSINDWANK
GYEVVASNPDYVYFDMPYEVNPNERGYYWATRFSDEAKVFSFAPDNMPQNAETSVDRDGN
HFSAKSDKPWPGVHGISGQSWNETVRTDEQMEYMIFPRVLPLAERAWHRASWEQDYKAGR
EYKGGETHMVDTKALSTDWQRFANIMGQRELAKLDKAGVAYRLPVPGARVVAGGLEANIS
LPGLIIEYSTDGGKQWQKYDVKAKLKVSGDVLIRSTSPDGKRSSRAEPVKV
NT seq 2676 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaattcagattaaatgcgttagcggcaatcaccgcaacctttggcttgatgggc
gctgcccatgcagatgccaccaatcaacagattgttgatcaactcagcgctttgaaagtt
aattataaagtgttggataaccgcgctgctgagaatggcgtagattgtgccaagttggga
gctgactgggcatcatgtaataaagtagtgattactctgaccaatactggggatgagatc
aaaggccaggactgggccatttacttccatagtattcgtcaaattctcaccgtagataat
gatcagtttaaaattactcacctgacgggtgatctacataaaattgaacctaccgccaaa
tttactggtttccctgccaatcaggcggttgaaatcccgatcaccggcgaatactggcag
ttatttgccaccgactttatgccgcgctggtatgccacttcgggtgatgcaaaaccaaaa
gttctgaaaagtactgatactgaagatattaatgaatatctgactcagtttacgggcgat
cagtggaagcgtactaaagacgacaataacgtattaatgacgccggaatctcgcttcgtc
aaaaatgagaccgtgaaaacattaacggcagctaacctgcgcgggcagattatcccgaca
ccaatggaagtgaaggttcaccaacaagatgcggatttgagtcaaggtgtggcgcttgac
ctgagcactttgcccaaaccggctgctgaggcggcggagcagcgttttgcattacttggc
ttgaagttgggttcaacagggttcccgattaaaaccttgattcagccgtctgcctttaaa
ggtgacttagccgtttcaggggcatatgagctgaaaatcggtgaaaagggcgcgcaagtg
attggttttgacccaacaggtgtgttttacggcctgcaatccattctttctttagtaccg
actgatggtagcaagaagattgcgacattggatgccaaagatgcgccacgctttgaatac
cgtggtgttttcctggatgtcgggcgtaacttcaaaactaaagatgcagtattgcgtttg
cttgatcagatggccgcttacaagctgaacaaattccacttccatctgagtgatgatgaa
ggctggcgtattgagataccaggcctgccagaactgaccgatgtgggcagcaagcgttgc
cacgatttaacggaaaacacctgcttactgccgcaattgggctctggcccggatagcaat
aatttgggctcgggtcactttacccgtgatgattacatcgacattttgaaatacgctaaa
gcccgccaaattgaggtcattcctgagattgatatgcccgctcacgcgcgtgcagccgtc
gtctcgatggaagctcgttacaacaatttgatgaagcagggtaaggaaaaagaagctaac
gagttccgcttggttgacccgacagatgattccaacacgacttctgttcagttctatgaa
cgcaaaagttatctcaacccatgtctggattcgtctaaacgctttgttgacaaagtgatt
ggcgaaatggctcaaatgcataaagaagcgggtatgccgctgaacacttggcattttggc
ggtgatgaggcgaaaaatatccgcctgggcgcgggatttcaggacaaaaatggtacgatt
gagccgggtaaaggcattattgataagagtattgaagataagccgtgggccaaatcacaa
gtttgccaggatatggtcaagcaaggaaaaattcaggatgttgagcacctttccagccac
tttgctattgaagtcagcaagctggtgaatgcccatggcattgaaaaaatgcaagcctgg
caagacggccttaaagatgccaagtcgtcgaaagactttgccacgaaacgggtgggcgtt
aacttctgggataccctctattgggggggggccgattcaatcaatgattgggccaataaa
ggctatgaagtggtcgcgtcgaatccggattatgtctacttcgacatgccatatgaagtt
aacccaaatgagcgcggctattactgggcgacacgcttcagcgacgaagctaaggtcttt
agtttcgcgccggataacatgccacaaaacgcggaaacctcggtcgaccgtgacggtaat
cattttagtgctaaaagtgataaaccttggccgggtgtgcacggtatttccggtcaatca
tggaatgaaacagtacgaactgatgaacaaatggaatacatgattttccctcgagtatta
ccactggccgaacgtgcctggcatcgtgcgtcttgggagcaggattataaagccggccgc
gagtacaaaggcggcgaaacccatatggtcgataccaaggcgttgagtaccgattggcag
cgctttgccaacatcatgggccaacgtgaattagcaaaactggataaagccggtgttgct
taccgtctaccagtgccaggggcgcgtgttgttgccgggggattggaagcgaatatttcc
ttgccggggctgattatcgagtattccactgatggcggtaagcaatggcagaagtatgat
gtcaaagccaaactcaaggtcagcggcgatgtgttgatccgctcgaccagtccggatggc
aaacgtagtagtcgtgcggagccggttaaggtttga

DBGET integrated database retrieval system