KEGG   Yersinia enterocolitica subsp. palearctica Y11: Y11_19041Help
Entry
Y11_19041         CDS       T02010                                 

Definition
(GenBank) asparagine synthetase [glutamine-hydrolyzing]
  KO
K01953  asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
yey  Yersinia enterocolitica subsp. palearctica Y11
Pathway
yey00250  Alanine, aspartate and glutamate metabolism
yey01100  Metabolic pathways
yey01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:yey00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Y11_19041
Enzymes [BR:yey01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     Y11_19041
Peptidases [BR:yey01002]
 Cysteine Peptidases
  Family C44
   Y11_19041
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asn_synthase GATase_7 GATase_6 DUF3700 NAD_synthase
Motif
Other DBs
NCBI-ProteinID: CBY26277
UniProt: A0A0H3NPF1
Position
1927428..1929092
Genome map
AA seq 554 aa AA seqDB search
MCSIFGVLDLKTDPIELRKKALEMSRLMRHRGPDWSGVWANDKAILAHERLSIVDVNTGA
QPLFNAAHTHILAVNGEIYNHQALRQQYGDRYKFQTWSDCEVILALYQEKGPEFLDDLQG
MFAFVLYDTEKDAYLIGRDHLGIIPLYVGHDEHGNMFVASEMKALVPVCRTIKEFPAGSY
LWSQDGEIREYYHRDWFDFDNVKNNVTDKVELANALEDAVKSHLMSDVPYGVLLSGGLDS
SVISAITKKFAARRVEDDERSEAWWPQLHSFAVGLIGSPDLRAAQEVANHLGTVHHEIHF
TVQEGLDAIRDVIYHIETYDVTTIRASTPMYLMSRKIKAMGIKMVLSGEGSDEVFGGYLY
FHKAPNAKELHEETVRKLLALHMYDCARANKAMSAWGVEARVPFLDKNFLDVAMRINPQD
KMCGNGKMEKHVLRECFESYLPHSVAWRQKEQFSDGVGYNWIDTLKEKAAEQVTDQQMET
AHFRFPYNTPSSKEGYLYREIFEELFPLPSAAECVPGGPSVACSSAKAIEWDESFKSMDD
PSGRAVGVHQDAYK
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atgtgttctattttcggggtcctcgaccttaaaactgaccccattgagttacgcaaaaaa
gcgctggaaatgtcacgtctaatgcgccaccgcggcccggactggtcaggtgtatgggca
aatgataaagccatactcgcccatgaacgcttatctattgttgacgtcaatactggtgca
cagcccctgtttaacgcggcgcacacacatattctggcggtcaatggtgaaatttataat
catcaggcattacgccagcaatacggcgaccgttataaattccagacctggtctgactgt
gaagtcattctggcgctgtatcaggagaaagggcctgaattccttgacgacctgcaaggt
atgttcgctttcgtcctatacgatacggaaaaagacgcttacctgattgggcgtgaccac
ctgggtattatcccgctgtacgtgggccacgatgaacacggtaatatgtttgtggcttca
gaaatgaaagccttggttccggtttgccgtaccatcaaagaattcccggccggaagctat
ctgtggagtcaggatggcgaaattcgcgagtattatcatcgcgactggtttgatttcgat
aatgtcaaaaacaatgtcactgataaagttgaactggcaaatgcgttagaagatgcggtt
aaaagtcatttgatgtccgacgttccttacggcgtgctgctctctggcggtctggattcc
tcggttatttcggctatcaccaaaaaatttgcggctcgtcgcgtagaagatgatgaacgc
agtgaagcctggtggccacaattgcactccttcgccgtgggtttgataggttcacctgat
ttgcgcgccgcgcaagaggtcgccaaccatttgggtaccgtgcatcatgaaattcacttc
accgtgcaggaaggtctggatgccatccgtgatgtgatttatcacattgaaacttatgat
gtcaccactatccgcgcctcaacaccaatgtacttgatgtcgcgtaaaatcaaggcgatg
ggtatcaaaatggtgctatctggtgaaggttctgacgaagtatttggcggttacctctat
ttccacaaagcgccaaatgccaaagaattgcatgaagaaaccgtgcgcaagctgttagcc
ctgcatatgtatgactgcgctcgtgccaacaaagcgatgtctgcctggggtgttgaagcg
cgtgtaccattcctggataaaaacttccttgatgtggcgatgcgaattaacccgcaggat
aaaatgtgcggtaatggcaaaatggaaaaacatgtactgcgtgaatgttttgaatcctac
ctgccacatagcgtcgcatggcgtcagaaagaacaattctccgatggtgtgggttacaac
tggattgatacattaaaagagaaagctgccgagcaagtcactgatcaacagatggaaact
gcgcacttccgttttccatacaacacgccgtcctccaaagagggctacttgtatcgagaa
atttttgaagagctattcccactgccaagtgcagcggaatgcgtgcctggcggcccttca
gtagcatgttcatcagctaaagctattgaatgggatgaatcattcaaaagcatggatgac
ccttctggtcgcgctgtaggcgtgcatcaggatgcttacaaataa

DBGET integrated database retrieval system