KEGG   Yersinia enterocolitica subsp. palearctica Y11: Y11_19751Help
Entry
Y11_19751         CDS       T02010                                 

Definition
arylesterase (EC:3.1.1.2)
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
yey  Yersinia enterocolitica subsp. palearctica Y11
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:yey00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Y11_19751
Enzymes [BR:yey01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Y11_19751
   3.1.2  Thioester hydrolases
    3.1.2.-  
     Y11_19751
Lipid biosynthesis proteins [BR:yey01004]
 Fatty acid synthase
  Component type
   Y11_19751
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1994461..1995096
Genome map
AA seq 211 aa AA seqDB search
MNFKNVFRWHLPFLLLLGLFSLRAAATDTLLILGDSLSAGYRLPIAEAWPSRLDKTWQAT
PSLPKVVNASISGDTAAQGLARLPALLKQHQPRWVLIELGANDGLRGFPPQDIQRNLTQV
INLIKEAKAQPLLMQIRIPPNYGRRYTDAFTAMYPQLAQQFGIPLVPFFMEQVAVKTEWM
QDDGLHPNALAQPFIADWMAQQLKPLVTNKS
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgaacttcaagaacgttttccgctggcatcttcccttcctattactattgggattattc
agtttgcgtgccgccgcaaccgatacacttttgattctcggcgacagtttaagcgccggt
taccgcctgccgattgctgaagcctggccctcgcggttggataaaacatggcaggccacc
ccatcattacccaaggtggttaacgccagtatcagtggtgatacggcggcccagggttta
gcccgtctgcctgccttgctgaaacaacatcagccccgctgggtactgattgaattaggt
gccaatgacggcctgcgcggtttcccaccgcaggatattcaacggaatctcacgcaagtt
atcaatctgataaaagaagcaaaagcgcaacctttgttgatgcaaatccgtattcctcct
aactatggccgccgttatactgatgctttcactgctatgtatccgcagcttgcacagcaa
tttggcatcccattggtacctttctttatggaacaagttgccgtaaaaaccgagtggatg
caggatgatggtttacatcctaacgcactggcgcaacctttcattgctgattggatggcg
caacaacttaaaccgttagtcaccaataagtcttag

DBGET integrated database retrieval system