KEGG   Yersinia enterocolitica subsp. palearctica Y11: Y11_20041Help
Entry
Y11_20041         CDS       T02010                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
yey  Yersinia enterocolitica subsp. palearctica Y11
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:yey03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2026171..2026776)
Genome map
AA seq 201 aa AA seqDB search
MQTSPLLESLMEALRCLPGVGPKSAQRMAFQLLQRDRSGGMRLAQSLTRAMSEIGHCADC
RTFTEQEHCTICSNPRRQQNGQICVVESPADIHAIEQTGQFGGRYFVLMGHLSPMDGIGP
GDIGLDLLEKRLETETISEVILATNPTVEGDATANYIGQMCGQYGVLASRIAHGVPVGGE
LEMVDGTTLSHSLAGRNPIKY
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaccagcccactccttgaatcattgatggaggcgttgcgctgcttgccgggcgtt
ggcccgaaatcggcgcaacgtatggcatttcaattgctacagcgggatcgtagcggtgga
atgcgcctggcacagtcattgacgcgcgcaatgtctgaaattggccactgcgctgactgc
cgtacttttaccgagcaagagcattgcactatttgctctaatccgcggcggcaacaaaat
ggtcaaatctgcgtggtcgaaagcccggcagatattcatgccattgagcaaacgggccag
tttggcgggcgctattttgtgttgatggggcatttatctcccatggacggcataggtccc
ggtgatattggtttggatttgcttgaaaaacggctggaaactgaaactatcagtgaagtc
attctggcgaccaacccgacagtcgaaggggatgcaaccgctaactatattggtcagatg
tgcggccagtatggtgtgttagccagccgtattgcacacggtgtgccagttggcggtgag
ttggaaatggttgatggtacaaccctatcccactcattagcggggcgtaatcccattaag
tactag

DBGET integrated database retrieval system