KEGG   Yersinia enterocolitica subsp. palearctica Y11: Y11_20041Help
Entry
Y11_20041         CDS       T02010                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
yey  Yersinia enterocolitica subsp. palearctica Y11
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:yey00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Y11_20041
DNA repair and recombination proteins [BR:yey03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Y11_20041
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2026171..2026776)
Genome map
AA seq 201 aa AA seqDB search
MQTSPLLESLMEALRCLPGVGPKSAQRMAFQLLQRDRSGGMRLAQSLTRAMSEIGHCADC
RTFTEQEHCTICSNPRRQQNGQICVVESPADIHAIEQTGQFGGRYFVLMGHLSPMDGIGP
GDIGLDLLEKRLETETISEVILATNPTVEGDATANYIGQMCGQYGVLASRIAHGVPVGGE
LEMVDGTTLSHSLAGRNPIKY
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaccagcccactccttgaatcattgatggaggcgttgcgctgcttgccgggcgtt
ggcccgaaatcggcgcaacgtatggcatttcaattgctacagcgggatcgtagcggtgga
atgcgcctggcacagtcattgacgcgcgcaatgtctgaaattggccactgcgctgactgc
cgtacttttaccgagcaagagcattgcactatttgctctaatccgcggcggcaacaaaat
ggtcaaatctgcgtggtcgaaagcccggcagatattcatgccattgagcaaacgggccag
tttggcgggcgctattttgtgttgatggggcatttatctcccatggacggcataggtccc
ggtgatattggtttggatttgcttgaaaaacggctggaaactgaaactatcagtgaagtc
attctggcgaccaacccgacagtcgaaggggatgcaaccgctaactatattggtcagatg
tgcggccagtatggtgtgttagccagccgtattgcacacggtgtgccagttggcggtgag
ttggaaatggttgatggtacaaccctatcccactcattagcggggcgtaatcccattaag
tactag

DBGET integrated database retrieval system