KEGG   Yersinia enterocolitica subsp. palearctica Y11: Y11_21591Help
Entry
Y11_21591         CDS       T02010                                 

Definition
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase (EC:1.13.11.54)
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
yey  Yersinia enterocolitica subsp. palearctica Y11
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Module
Methionine salvage pathway
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:yey00270]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2196245..2196787)
Genome map
AA seq 180 aa AA seqDB search
MSGLTIFSDEQPEQPLWQSRDAEEIQQQLTAIGVRFERWQADRELGENPQPDAVIAAYQH
EIDRLVAEKGYQSWDVISMRPDNEQREVLREKFLSEHTHGEDEVRFFVEGAGLFCLHLNN
NIYQILCEKNDLLSVPADTPHWFDMGSKPNFTAIRVFDNPEGWVARFTGDKIADAYPRLD
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atgagcggattaaccatttttagtgatgagcagccagaacaaccgctgtggcaaagccga
gatgctgaggaaattcaacagcaattgaccgctattggcgtacgatttgagcgctggcag
gcggatcgcgagctgggcgagaacccacaaccggacgctgtgattgcagcttatcagcat
gagattgaccggctggtagcggaaaagggctatcagagctgggatgtgatcagtatgcgt
cctgataatgagcagcgtgaagtattgcgcgagaaattcttatcagaacatacccacggt
gaagatgaagtgcgtttctttgtcgaaggagctgggttattttgcttgcatctcaataat
aacatttaccaaattctttgtgaaaagaatgatttactctcagttccagcggatacaccg
cattggtttgatatgggttctaaaccgaattttaccgctattcgggtatttgataatcca
gagggttgggtagcgcgttttaccggcgataagatagccgatgcctacccgcgcctggat
taa

DBGET integrated database retrieval system