KEGG   Yersinia enterocolitica subsp. palearctica Y11: Y11_22471Help
Entry
Y11_22471         CDS       T02010                                 

Definition
cytochrome c551 peroxidase (EC:1.11.1.5)
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
yey  Yersinia enterocolitica subsp. palearctica Y11
Brite
Enzymes [BR:yey01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     Y11_22471
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2294231..2295652
Genome map
AA seq 473 aa AA seqDB search
MIRKWLIGGGILIVAGYLGVAGYIYMTDNARSDTLISEEKQLTNESSPTVSNTKITAQQI
SHLLYQKGCDYCHTSSASLPFYAAIPGVKQLMAYDIQQGSQYFSLEPTLLAIKENRAVPE
ADLAKIESAIAREQMPPQRFAVLHWASSINAEERNQILDWVKSQRAEYFPSTSSRDLQHL
TLQPLPDALPVDSKKVALGSRLFHDPRLSSDNTVSCASCHQLTKGGVDNLATSTGVDGQK
GGINAPTVFNAVFNVNQFWDGRAVDLQQQAGGPPLNPVEMASASWDDIIGKLQQDAQLTQ
EFLQVYPQGYSEHNITDAIAEFEKTLTTPNSPFDRYLKGDADALTASQKNGLALFQKNKC
DTCHVGKNIGGQSYDLMGLKGNYFADRPKELTADDQGRFNITKDPRDMHRFKTPGLRNIA
LTAPYFHDAQAENLNQAVEMMLKYQVGTSLPSQDINDIVAFLESLTGEYTPHK
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
gtgataagaaaatggctaattggcggaggtatattaatagttgcaggttatctgggtgtc
gcaggttatatctacatgacagataacgcccgcagtgacacattaatcagcgaggaaaaa
caattaaccaatgagtcgtcccccacggtaagtaataccaaaataaccgctcaacagatc
agtcatctgctttatcaaaagggctgcgattactgccacaccagcagtgcctctctaccg
ttttatgccgctattccgggcgtgaaacaattaatggcttacgatattcaacaaggtagc
caatatttctcattggaaccgaccttattagctattaaagaaaatcgcgccgtacctgaa
gcagatttagcaaaaattgaatcggctattgctcgcgaacaaatgccaccacaacgtttt
gccgttttgcactgggcttcgagtatcaatgctgaagaaagaaaccaaattctcgattgg
gttaaatcacaacgagcagaatatttcccttcaaccagcagccgtgatctgcaacatctc
accttacaaccgctgccggatgcattacctgtcgacagtaaaaaagtggcattgggttct
cgcctattccacgatccacggttatccagtgataacaccgtatcttgcgccagctgccat
cagcttacaaaaggtggagtcgataatctggcgacctcaaccggtgttgatggtcagaaa
ggtgggattaatgcaccgacagtcttcaacgccgtattcaatgtgaatcaattctgggat
ggccgcgcggttgatttacaacaacaagccggtggtccgccactgaatccggtagaaatg
gcgtcagcatcgtgggatgacatcattgggaaactgcaacaggatgcccagttaacacaa
gagtttcttcaggtttatccgcagggctattccgaacacaatattactgacgctattgct
gaatttgaaaaaacgctgaccacgccaaatagtccctttgatcgctatttaaaaggtgat
gccgatgccctcaccgccagccagaaaaacggcctggcattattccagaaaaataaatgc
gacacctgccatgtgggtaaaaatattggcgggcagtcgtatgacctgatgggattaaaa
ggcaattactttgctgaccggccgaaagagctgacggcggatgaccaagggcgttttaat
atcactaaagatccgcgcgatatgcaccgttttaaaacaccgggtctgcgtaatattgct
ctgacagccccttatttccacgatgctcaagctgagaatttgaatcaggcagttgaaatg
atgttgaaatatcaggtgggcactagcctgccatcacaggatattaacgatatcgtcgct
ttccttgaaagcctgaccggggaatatactccacataaataa

DBGET integrated database retrieval system