KEGG   Yersinia enterocolitica subsp. palearctica Y11: Y11_25581Help
Entry
Y11_25581         CDS       T02010                                 

Definition
beta-hexosaminidase (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
yey  Yersinia enterocolitica subsp. palearctica Y11
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Module
beta-Lactam resistance, AmpC system
Brite
KEGG Orthology (KO) [BR:yey00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Y11_25581
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    Y11_25581
Enzymes [BR:yey01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Y11_25581
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2585850..2587721)
Genome map
AA seq 623 aa AA seqDB search
MKKLIPAILLFSTCTYADVIPDAQLKDMWLSPKISAEKAISKMSFEEKLGQILMVDIRSW
SHTDNSDKTAFIEINEAVSKMIRDYHLGSLILFRENLIDTPQTVTLINNLQNARSNLPLF
ISTDQEGGYVTRLRVGTEMPGNMALGATGSSKFAQQAGSIHSYELSSLGFNFNFGPVVDV
NNNQNNPVIGVRSYSNDPVLVAELARSYISGIHKYNVLTSLKHFPGHGNVTSDTHFSLPE
VNIDKAAWQQVELKPFVEVMPVTDAIMTAHVVVPALDNSMLTNNKGEKVGTPATLSKPIL
TDILRNQLKFDGLILTDAMDMGAITSNFERNWSIKQAIMAGNDIVLMPMEIKNRASIEQL
DALYDYLKTEATKDPELKQRIEDSAQRVIYTKLNKRISPEPHDIAIAEKVVASKNHKNIE
NFISEQAITLIKNDNILPYQVKPQNKIIVFSDERPRNELITKHLDDIANKFNVDFIVKNK
VIKLGECDANPEDIAKQIKAQDLIILATYNLKLEPINAQRIIDEANRVNIPLVVISSRNP
YDIAYLSGVKANIAIYGITGFDVTNNVRNSLETNIRSGLRSLFQGPKGKLDVLAEPHGKL
PVDIRTPDNSQILYPRGYGLTTL
NT seq 1872 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaattaatacctgcgattctcttatttagcacctgtacttatgcagatgttatt
ccagatgcacaacttaaagatatgtggttgtcaccaaagatatctgctgaaaaagccata
tcaaaaatgagttttgaagaaaaattggggcaaatattaatggttgatattcgctcctgg
agtcatacggataacagcgacaaaacagcattcattgagattaatgaggctgtcagtaag
atgattcgcgattatcatttaggttctcttattcttttccgtgaaaacctgattgatact
ccacaaacagttacgttaattaataatcttcaaaatgcgcgcagcaatctccctctgttt
attagcaccgatcaggaaggagggtatgtcactcgtctacgagtaggtactgaaatgcca
ggaaatatggcattaggggcaaccggatcatccaagtttgctcagcaggctggaagtatc
cacagttatgaattatctagcttgggttttaactttaattttggccctgtcgttgatgtt
aataataatcagaataaccctgtcattggcgtgcgttcttattccaatgatccggtgttg
gtggcggagttagcccgtagttatattagtggcattcataaatacaatgtactcacctca
ctcaaacattttccaggtcatggaaatgtcacctcagatacacatttttccttgccggaa
gtcaatattgataaagctgcatggcagcaagtcgaactgaaaccctttgttgaagtcatg
ccagtgactgatgcaattatgactgcccatgtggttgtgccagctctggataattcaatg
ttaacaaataataagggcgaaaaagtgggcactccagccacattatcaaagcccatcctg
actgatatcttacgtaatcagctcaagtttgatggcttgatcctgacagatgctatggat
atgggcgcgattaccagtaactttgagcgtaattggtctatcaagcaggccattatggca
ggcaatgatattgtcttaatgccaatggaaattaagaaccgcgccagtattgaacaactc
gatgcactttatgattatttaaaaaccgaagccacaaaagatcctgagcttaaacaacgt
attgaggattcagcacagcgagtcatttacaccaaactgaataagcgtatttctcctgaa
ccgcatgatattgctatcgcggaaaaagttgtcgcatcaaaaaatcataagaatattgaa
aattttatttctgaacaggctattacactaataaaaaatgataatattttaccttatcaa
gtaaaaccacaaaataagataatagtattctctgacgagagacctcgcaacgaactcatt
actaaacatcttgatgatattgctaataaatttaacgttgactttatcgttaagaataaa
gtaataaaattgggtgaatgcgatgcaaatcctgaagatatcgccaaacagattaaagcc
caagatcttattattcttgctacctataatcttaaactcgaaccaattaatgcgcagcgg
atcatcgatgaagccaatagggttaatatccctttagtcgttatatcaagtcgaaatcct
tatgatattgcttatctgtccggcgtaaaggcgaatattgctatttatggtattaccggg
ttcgatgtgaccaataatgtacgaaacagtttagaaactaatatccgcagtgggttaaga
tcgctatttcaggggccaaaaggtaaattagatgtattggccgagccacatgggaagtta
ccggtggatattagaactcctgataatagccagatactctatccacgtggttatggatta
acgacgttataa

DBGET integrated database retrieval system