KEGG   Yersinia enterocolitica subsp. palearctica Y11: Y11_27841Help
Entry
Y11_27841         CDS       T02010                                 

Definition
(GenBank) isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
yey  Yersinia enterocolitica subsp. palearctica Y11
Pathway
yey00630  Glyoxylate and dicarboxylate metabolism
yey01100  Metabolic pathways
yey01110  Biosynthesis of secondary metabolites
yey01120  Microbial metabolism in diverse environments
yey01200  Carbon metabolism
Module
yey_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:yey00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Y11_27841
Enzymes [BR:yey01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     Y11_27841
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase ETC_C1_NDUFA4
Motif
Other DBs
NCBI-ProteinID: CBY25397
UniProt: A0A0H3NQJ4
Position
complement(2839686..2840993)
Genome map
AA seq 435 aa AA seqDB search
MTTSRTQQIQQLEQEWKSLRWEGIIRPYSAEEVIKLRGSVNPECTLAQHGAKRLWELLHG
KSRKDYINCLGALTGGQALQQAKAGVEAIYLSGWQVAADANTASSMYPDQSLYPVDSVPA
VVKRINNSFRRADQIQWSNNIEPGSKGYTDYFLPIVADAEAGFGGVLNAFELMKAMIEAG
AAGVHFEDQLAAVKKCGHMGGKVLVPTQEAIQKLVAARLAADVLGVPTLLIARTDADAAD
LLTSDCDPHDSEFITGDRTAEGFFRTHAGIEQAISRGLAYAPYADLVWCETSTPDLALAK
RFADAIHAQFPGKLLAYNCSPSFNWKKNLTDQQIASFQDDLSAMGYKYQFITLAGIHSMW
FNMFDLAHAYAQGEGMKHYVEKVQQPEFAAVERGYTFASHQQEVGTGYFDKVTNIIQGGE
SSVTALTGSTEEQQF
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgactacctctcgtactcaacaaattcagcaattggaacaggaatggaaatcactacgc
tgggagggcattattcgcccgtatagtgctgaagaagtgattaaattacgtggctcagtc
aaccctgagtgtactttggcgcagcacggtgcgaagagattgtgggaattactgcacggc
aaatcgcgcaaagattatatcaactgtttaggtgcattaaccggcggtcaggcactgcaa
caggcgaaggccggggttgaggccatttatctgtcaggctggcaggttgcggctgatgct
aataccgcatcaagcatgtacccggatcaatcgctgtacccggttgactccgttccagca
gtggttaaacgtatcaataacagtttccgtcgcgcagatcagattcaatggtcgaataat
attgagccgggtagcaaaggttataccgactatttcctgccgattgtagcagatgcggaa
gccggttttggtggtgtactgaatgcgttcgaattgatgaaggctatgattgaggcgggt
gctgccggcgtacatttcgaagatcaactggcagccgtgaagaaatgtggtcatatgggc
ggtaaagttttggtaccgactcaggaagcgattcagaagttggtcgctgcccgtctggct
gccgacgttcttggtgtaccaacactgctgattgcccgtaccgatgctgatgccgctgat
ttgctgacttctgattgtgacccgcatgatagcgaattcattactggcgatcgcactgct
gaaggattcttccgcactcatgctggtattgagcaagctatcagccgcggtctggcttat
gccccgtatgccgatttggtgtggtgcgaaacctcaacgccagacctggcgttagccaaa
cgttttgctgatgcgattcacgcacaattccctggtaaattattggcttacaactgttcg
ccatcatttaactggaaaaagaacctgacggaccaacagattgccagcttccaggatgac
ctgtcggcgatgggctacaaataccagtttattactctggcgggcatccacagcatgtgg
ttcaacatgtttgacctagcccatgcttatgcgcagggtgagggcatgaagcactatgtt
gagaaggttcagcagcccgaatttgcggctgttgagcgcggctatacttttgcatcccat
caacaagaagtgggtaccggctattttgataaagtcaccaatatcattcagggcggcgag
tcttccgtgacagcattgaccggctcgacggaagaacagcaattttag

DBGET integrated database retrieval system