KEGG   Yersinia enterocolitica subsp. palearctica Y11: Y11_27841Help
Entry
Y11_27841         CDS       T02010                                 

Definition
isocitrate lyase (EC:4.1.3.1)
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
yey  Yersinia enterocolitica subsp. palearctica Y11
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:yey00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Y11_27841
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Y11_27841
Enzymes [BR:yey01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     Y11_27841
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2839686..2840993)
Genome map
AA seq 435 aa AA seqDB search
MTTSRTQQIQQLEQEWKSLRWEGIIRPYSAEEVIKLRGSVNPECTLAQHGAKRLWELLHG
KSRKDYINCLGALTGGQALQQAKAGVEAIYLSGWQVAADANTASSMYPDQSLYPVDSVPA
VVKRINNSFRRADQIQWSNNIEPGSKGYTDYFLPIVADAEAGFGGVLNAFELMKAMIEAG
AAGVHFEDQLAAVKKCGHMGGKVLVPTQEAIQKLVAARLAADVLGVPTLLIARTDADAAD
LLTSDCDPHDSEFITGDRTAEGFFRTHAGIEQAISRGLAYAPYADLVWCETSTPDLALAK
RFADAIHAQFPGKLLAYNCSPSFNWKKNLTDQQIASFQDDLSAMGYKYQFITLAGIHSMW
FNMFDLAHAYAQGEGMKHYVEKVQQPEFAAVERGYTFASHQQEVGTGYFDKVTNIIQGGE
SSVTALTGSTEEQQF
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgactacctctcgtactcaacaaattcagcaattggaacaggaatggaaatcactacgc
tgggagggcattattcgcccgtatagtgctgaagaagtgattaaattacgtggctcagtc
aaccctgagtgtactttggcgcagcacggtgcgaagagattgtgggaattactgcacggc
aaatcgcgcaaagattatatcaactgtttaggtgcattaaccggcggtcaggcactgcaa
caggcgaaggccggggttgaggccatttatctgtcaggctggcaggttgcggctgatgct
aataccgcatcaagcatgtacccggatcaatcgctgtacccggttgactccgttccagca
gtggttaaacgtatcaataacagtttccgtcgcgcagatcagattcaatggtcgaataat
attgagccgggtagcaaaggttataccgactatttcctgccgattgtagcagatgcggaa
gccggttttggtggtgtactgaatgcgttcgaattgatgaaggctatgattgaggcgggt
gctgccggcgtacatttcgaagatcaactggcagccgtgaagaaatgtggtcatatgggc
ggtaaagttttggtaccgactcaggaagcgattcagaagttggtcgctgcccgtctggct
gccgacgttcttggtgtaccaacactgctgattgcccgtaccgatgctgatgccgctgat
ttgctgacttctgattgtgacccgcatgatagcgaattcattactggcgatcgcactgct
gaaggattcttccgcactcatgctggtattgagcaagctatcagccgcggtctggcttat
gccccgtatgccgatttggtgtggtgcgaaacctcaacgccagacctggcgttagccaaa
cgttttgctgatgcgattcacgcacaattccctggtaaattattggcttacaactgttcg
ccatcatttaactggaaaaagaacctgacggaccaacagattgccagcttccaggatgac
ctgtcggcgatgggctacaaataccagtttattactctggcgggcatccacagcatgtgg
ttcaacatgtttgacctagcccatgcttatgcgcagggtgagggcatgaagcactatgtt
gagaaggttcagcagcccgaatttgcggctgttgagcgcggctatacttttgcatcccat
caacaagaagtgggtaccggctattttgataaagtcaccaatatcattcagggcggcgag
tcttccgtgacagcattgaccggctcgacggaagaacagcaattttag

DBGET integrated database retrieval system