KEGG   Yersinia enterocolitica subsp. palearctica Y11: Y11_27851Help
Entry
Y11_27851         CDS       T02010                                 

Definition
(RefSeq) malate synthase (EC:2.3.3.9)
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
yey  Yersinia enterocolitica subsp. palearctica Y11
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:yey00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Y11_27851
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Y11_27851
   00630 Glyoxylate and dicarboxylate metabolism
    Y11_27851
Enzymes [BR:yey01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Y11_27851
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(2841166..2842764)
Genome map
AA seq 532 aa AA seqDB search
MTQQLVGTELVFTQYFNAAERQVLPDEAIEFLTELVVKFAQSRRELLAARVSWQKNIDQG
ALPYFISETNSIREGDWRIQGIPADLRDRRVEITGPVERKMVINALNANVKVFMADFEDS
LAPSWDKVIDGQINLHDAVKGTISYANESGKIYQLKPNPAVLIARVRGLHLPEKHVKWQG
EDIPGGLFDFALYFYHNYKQLLANGSGPYFYLPKMQSYQEAAWWSDVFTFTEQRFGLPQG
TIKATVLIETLPAVFQMDEIIYHLHHHIVGLNCGRWDYIFSYIKTLKNHGDRVLPDRQSV
TMNKPFLSAYSRLLIKTCHKRGALAMGGMAAFIPNKDPVKNAQVLDKVRADKELEASNGH
DGTWVAHPGLADTVMEVFNKVLGDRPNQLEVSRAQDKPITAAELLEPCSGERTEEGMRAN
IRVAVQYIEAWISGNGCVPIYGLMEDAATAEISRTSIWQWIHHQKNLSNGQTVTKELFRN
MLSEEMQVVKLELGTERFDGGRFEEAARLMERITTQDELIDFLTLPGYALLA
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgacacaacagttagtcggcacggagttagtttttacacagtattttaatgctgctgaa
agacaggttttaccggatgaagcgatcgaattcttgaccgaattggtggtgaaattcgcg
cagtcacgtcgtgaactccttgccgcacgggtatcctggcaaaaaaatatcgatcaaggt
gccttgccatattttatttcggaaactaattccattcgtgaaggtgactggagaattcag
gggattcctgctgacttacgtgatcgtcgggtggaaattaccgggccggttgagcgaaaa
atggtgattaatgctctcaatgccaatgtaaaagtctttatggctgatttcgaagactcg
ttggcaccaagctgggacaaagtgattgatggtcaaattaatctgcatgatgcggtaaaa
ggtactatttcctatgcaaatgaatccggcaagatttatcaactcaaacccaacccagcg
gtattgattgcgcgagttcgcggtctgcatttgccagaaaaacatgtgaaatggcagggg
gaagatattcctggtggactgttcgatttcgctttgtatttctatcataactataagcaa
ttacttgccaatggcagcggcccttatttttatttgccgaaaatgcagtcttatcaggaa
gccgcttggtggagtgatgttttcacctttaccgagcagcgcttcggcttaccgcaaggc
accattaaagccacggtattaattgaaacattaccagccgtattccaaatggatgagatt
atctatcacctgcaccaccatattgttggcctgaattgtggccgctgggattatatattc
agctatatcaaaacactgaaaaatcacggtgatcgtgtgttgccagaccgccaatcggtc
accatgaataaaccattcctaagcgcgtattcccgtttattgatcaaaacctgccataaa
cgcggtgctttagcgatgggtggtatggcggcatttatcccgaataaagatccggtaaaa
aatgcgcaagtactggataaagtccgtgcggataaagagttagaagccagtaatggccat
gatggtacatgggtagcccatccagggctggccgataccgtgatggaagtctttaacaag
gtgttgggtgaccggccaaatcaattagaggttagccgagcgcaggacaaacctataacc
gcagctgagttgttggagccttgcagtggtgaacgcacggaagaagggatgcgcgccaat
atccgggttgctgtgcaatacatcgaagcatggatatctggcaatggttgcgtgccgatt
tatggcctgatggaagatgccgcgacggcagagatttcccgtacttctatctggcaatgg
atacatcaccagaaaaacctgagtaatggtcaaacggtgacgaaagagctgttccgaaac
atgttgagtgaagaaatgcaggtagtgaagctggaacttggcacagagcgctttgatggc
gggcggtttgaagaagctgcgcgtttgatggaacgaattacaacacaagacgagcttatc
gacttcctaacactacccggctacgcactattagcctga

DBGET integrated database retrieval system