KEGG   Yersinia enterocolitica subsp. palearctica Y11: Y11_27851Help
Entry
Y11_27851         CDS       T02010                                 

Definition
(GenBank) malate synthase
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
yey  Yersinia enterocolitica subsp. palearctica Y11
Pathway
yey00620  Pyruvate metabolism
yey00630  Glyoxylate and dicarboxylate metabolism
yey01100  Metabolic pathways
yey01110  Biosynthesis of secondary metabolites
yey01120  Microbial metabolism in diverse environments
yey01200  Carbon metabolism
Module
yey_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:yey00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Y11_27851
   00630 Glyoxylate and dicarboxylate metabolism
    Y11_27851
Enzymes [BR:yey01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Y11_27851
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase HpcH_HpaI
Motif
Other DBs
NCBI-ProteinID: CBY25396
UniProt: A0A0H3NJY1
Position
complement(2841166..2842764)
Genome map
AA seq 532 aa AA seqDB search
MTQQLVGTELVFTQYFNAAERQVLPDEAIEFLTELVVKFAQSRRELLAARVSWQKNIDQG
ALPYFISETNSIREGDWRIQGIPADLRDRRVEITGPVERKMVINALNANVKVFMADFEDS
LAPSWDKVIDGQINLHDAVKGTISYANESGKIYQLKPNPAVLIARVRGLHLPEKHVKWQG
EDIPGGLFDFALYFYHNYKQLLANGSGPYFYLPKMQSYQEAAWWSDVFTFTEQRFGLPQG
TIKATVLIETLPAVFQMDEIIYHLHHHIVGLNCGRWDYIFSYIKTLKNHGDRVLPDRQSV
TMNKPFLSAYSRLLIKTCHKRGALAMGGMAAFIPNKDPVKNAQVLDKVRADKELEASNGH
DGTWVAHPGLADTVMEVFNKVLGDRPNQLEVSRAQDKPITAAELLEPCSGERTEEGMRAN
IRVAVQYIEAWISGNGCVPIYGLMEDAATAEISRTSIWQWIHHQKNLSNGQTVTKELFRN
MLSEEMQVVKLELGTERFDGGRFEEAARLMERITTQDELIDFLTLPGYALLA
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgacacaacagttagtcggcacggagttagtttttacacagtattttaatgctgctgaa
agacaggttttaccggatgaagcgatcgaattcttgaccgaattggtggtgaaattcgcg
cagtcacgtcgtgaactccttgccgcacgggtatcctggcaaaaaaatatcgatcaaggt
gccttgccatattttatttcggaaactaattccattcgtgaaggtgactggagaattcag
gggattcctgctgacttacgtgatcgtcgggtggaaattaccgggccggttgagcgaaaa
atggtgattaatgctctcaatgccaatgtaaaagtctttatggctgatttcgaagactcg
ttggcaccaagctgggacaaagtgattgatggtcaaattaatctgcatgatgcggtaaaa
ggtactatttcctatgcaaatgaatccggcaagatttatcaactcaaacccaacccagcg
gtattgattgcgcgagttcgcggtctgcatttgccagaaaaacatgtgaaatggcagggg
gaagatattcctggtggactgttcgatttcgctttgtatttctatcataactataagcaa
ttacttgccaatggcagcggcccttatttttatttgccgaaaatgcagtcttatcaggaa
gccgcttggtggagtgatgttttcacctttaccgagcagcgcttcggcttaccgcaaggc
accattaaagccacggtattaattgaaacattaccagccgtattccaaatggatgagatt
atctatcacctgcaccaccatattgttggcctgaattgtggccgctgggattatatattc
agctatatcaaaacactgaaaaatcacggtgatcgtgtgttgccagaccgccaatcggtc
accatgaataaaccattcctaagcgcgtattcccgtttattgatcaaaacctgccataaa
cgcggtgctttagcgatgggtggtatggcggcatttatcccgaataaagatccggtaaaa
aatgcgcaagtactggataaagtccgtgcggataaagagttagaagccagtaatggccat
gatggtacatgggtagcccatccagggctggccgataccgtgatggaagtctttaacaag
gtgttgggtgaccggccaaatcaattagaggttagccgagcgcaggacaaacctataacc
gcagctgagttgttggagccttgcagtggtgaacgcacggaagaagggatgcgcgccaat
atccgggttgctgtgcaatacatcgaagcatggatatctggcaatggttgcgtgccgatt
tatggcctgatggaagatgccgcgacggcagagatttcccgtacttctatctggcaatgg
atacatcaccagaaaaacctgagtaatggtcaaacggtgacgaaagagctgttccgaaac
atgttgagtgaagaaatgcaggtagtgaagctggaacttggcacagagcgctttgatggc
gggcggtttgaagaagctgcgcgtttgatggaacgaattacaacacaagacgagcttatc
gacttcctaacactacccggctacgcactattagcctga

DBGET integrated database retrieval system