KEGG   Yersinia enterocolitica subsp. palearctica Y11: Y11_28271Help
Entry
Y11_28271         CDS       T02010                                 

Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
yey  Yersinia enterocolitica subsp. palearctica Y11
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:yey00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Y11_28271
Enzymes [BR:yey01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Y11_28271
Exosome [BR:yey04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Y11_28271
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2896929..2898452
Genome map
AA seq 507 aa AA seqDB search
MTTENTTQKKYIVALDQGTTSSRAVVLDHDANIVSISQREFEQIYPKAGWVEHDPMEIWA
TQSSTLVEVLAKAGISSDEIAGIGITNQRETTIVWDKTTGKPVYNAIVWQCRRTAEICEK
LKKEGLEEYIRHNTGLVVDPYFSGTKVKWILDNVEGARDRAERGELLFGTVDTWLVWNMT
QGRVHVTDYTNASRTMMFNIRTKEWDERMLKALNIPRSMLPEVRPSSEVYGQTNIGGKGG
TRIPIAGIAGDQQAALFGQLCVQPGMAKNTYGTGCFLLMNTGTEAVQSNHGLLTTIACGP
RGEVNYALEGAVFIGGASIQWLRDELKLISDADDSEYFATKVKDSNGVYVVPAFTGLGAP
YWDPYARGAIFGLTRGVNSNHIIRATLESIAYQTRDVLDAMQADSGERLKSLRVDGGAVA
NNFLMQFQADILGTRVERPEVRESTALGAAFLAGLATGFWNDLDEVKSKATIEREFRPGI
ETTERDFRYKGWKKAVARAQAWEEHEE
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgacaactgaaaatactactcaaaagaaatacattgtcgcgcttgaccaaggaaccacc
agttccagagcagtggtgttggatcacgatgccaatatcgtgagtatctctcagcgcgaa
tttgagcaaatctacccaaaagcaggatgggttgagcatgacccaatggaaatctgggct
acccaaagctcgacattggtcgaagtgctagccaaagccggtatcagttctgatgaaatt
gctggcatcggtatcaccaaccaacgtgaaaccaccattgtttgggacaaaacaacaggt
aagccggtgtataacgccatcgtgtggcaatgccgccgtactgccgagatctgcgaaaaa
ctgaaaaaagaagggctggaagagtacatccgccacaacaccgggctagtcgtcgaccct
tacttctccggcaccaaggtgaaatggatccttgataacgtagaaggcgcgcgtgaccgt
gctgagcgcggcgagttgctgtttggtactgttgacacctggctagtgtggaatatgacg
caaggccgcgtacacgtaacggattacaccaacgcatcacgtaccatgatgtttaatatc
cgcaccaaagagtgggatgaacgtatgctgaaagcgctgaatatcccgcgctcaatgctg
cctgaagttcgcccatcctcagaagtttacggccagaccaacattggtggtaaaggcggg
actcgtattcctatcgccgggattgccggtgaccagcaagccgcgctgttcggccagctt
tgtgtccaaccgggaatggcaaaaaacacctacggtaccggctgcttcctgctgatgaac
actggcacagaagcagtgcaatccaatcatggcctgctgaccactatcgcctgcggccct
cgcggtgaagttaactatgcactggaaggtgcggtgtttattggcggtgcatccatccaa
tggttgcgtgatgagttgaagcttatcagtgatgccgatgactctgaatacttcgccacc
aaagtgaaagacagcaacggcgtgtatgtggtgcctgccttcaccggcctcggtgctcct
tattgggacccgtatgcgcgtggtgcaatctttggcctgacccgtggtgttaacagcaac
catattatccgtgcaacactcgaatctattgcttatcagactcgtgatgtactggatgcc
atgcaagcagattctggtgaacgcctgaaatcactacgtgttgatggtggtgcagttgcc
aacaacttcctgatgcagttccaggccgacattctgggcacgcgtgttgagcgcccagag
gtacgtgagagcacagcactgggtgccgcattcctggcaggtttggcaaccggcttctgg
aatgatttggacgaagtgaaaagtaaagcaaccattgagcgtgagttccgcccaggaata
gaaaccactgagcgtgatttccgttacaaaggctggaagaaagctgtagcccgcgcccaa
gcatgggaagagcacgaagagtaa

DBGET integrated database retrieval system