KEGG   Yersinia enterocolitica subsp. palearctica Y11: Y11_28361Help
Entry
Y11_28361         CDS       T02010                                 

Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
yey  Yersinia enterocolitica subsp. palearctica Y11
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:yey00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Y11_28361
   01230 Biosynthesis of amino acids
    Y11_28361
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Y11_28361
   00051 Fructose and mannose metabolism
    Y11_28361
   00562 Inositol phosphate metabolism
    Y11_28361
Enzymes [BR:yey01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Y11_28361
Exosome [BR:yey04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Y11_28361
  Exosomal proteins of bladder cancer cells
   Y11_28361
  Exosomal proteins of melanoma cells
   Y11_28361
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2911590..2912357
Genome map
AA seq 255 aa AA seqDB search
MRHPLVMGNWKLNGSTHMVNELIANLRKELSTVDGCGVAIAPPAIYLNQAKHELSGSRIA
LGAQNVDVNLSGAFTGETSAEMLKDVGAQYIIIGHSERRTYHNESDEFIAKKFGVLKEIG
LIPVLCIGETEAENEAGQTEAVCAKQLDAVLNTLGAKAFEGAVIAYEPIWAIGTGKSATP
AQAQAVHKFIRDHIAKQDAVIAAQVIIQYGGSVNDKNAAELFTQPDIDGALVGGASLKAD
AFAVIVKAAAKAKKA
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcatccattagttatgggtaactggaaactgaacggtagcactcacatggttaac
gagcttatcgctaacctgcgtaaagaactgagcactgttgacggctgtggcgttgctatt
gccccacctgctatctatctgaatcaagctaaacatgagctgtcaggtagccgcatcgcg
ctgggcgcacaaaacgttgatgtgaatctgtccggtgcatttaccggcgagacttctgct
gaaatgctgaaagatgttggtgctcaatacatcatcatcggccactctgagcgccgtact
tatcacaacgaaagtgatgaatttatcgcgaagaaatttggcgtactgaaagaaatcggc
ctgatcccagtattgtgcatcggtgaaaccgaagcagaaaacgaagccggccaaactgaa
gctgtttgcgctaagcaattagacgccgtgctgaacaccttgggtgctaaagcattcgaa
ggcgcggttatcgcttatgagccaatctgggctatcggtactggcaaatcagcaactcct
gcgcaggctcaagcggttcacaaatttatccgtgaccatatcgccaaacaagacgccgtc
attgccgcacaagttatcattcagtacggcggttccgtgaatgataaaaatgctgcagaa
ctgttcacccagccagatatcgatggcgcgctggttggcggtgcatcactgaaagctgat
gctttcgcggttatcgtgaaagccgctgcaaaagctaaaaaagcctaa

DBGET integrated database retrieval system