KEGG   Yersinia enterocolitica subsp. palearctica Y11: Y11_28391Help
Entry
Y11_28391         CDS       T02010                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
yey  Yersinia enterocolitica subsp. palearctica Y11
Pathway
yey00010  Glycolysis / Gluconeogenesis
yey00030  Pentose phosphate pathway
yey00051  Fructose and mannose metabolism
yey00052  Galactose metabolism
yey00680  Methane metabolism
yey01100  Metabolic pathways
yey01110  Biosynthesis of secondary metabolites
yey01120  Microbial metabolism in diverse environments
yey01130  Biosynthesis of antibiotics
yey01200  Carbon metabolism
yey01230  Biosynthesis of amino acids
yey03018  RNA degradation
Module
yey_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:yey00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Y11_28391
   00030 Pentose phosphate pathway
    Y11_28391
   00051 Fructose and mannose metabolism
    Y11_28391
   00052 Galactose metabolism
    Y11_28391
  Energy metabolism
   00680 Methane metabolism
    Y11_28391
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Y11_28391
Enzymes [BR:yey01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Y11_28391
Protein phosphatases and associated proteins [BR:yey01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Y11_28391
Messenger RNA biogenesis [BR:yey03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Y11_28391
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK DAGK_cat
Motif
Other DBs
NCBI-ProteinID: CBY25342
UniProt: A0A0H3NQG3
Position
complement(2914660..2915643)
Genome map
AA seq 327 aa AA seqDB search
MVKKIGVLTSGGDAPGMNAAIRGVVRAALSAGLEVYGIEDGYLGLFENRMRKLDRYSVSD
MINRGGTFLGSARFPEFRDPEKRKVALQNMKERGIDGLVVIGGDGSYAGADLLTKEGGIH
CVGLPGTIDNDVAGTDYTIGFFTALGTVVEAIDRLRDTSSSHQRISIVEVMGRYCGDLTL
AAAIAGGCEFIAIPEVEFKREDLVAEIKAGIEKGKKHAIVAITEKLDNIDELAKYIEQET
GRETRGTVLGHIQRGGAPVPYDRILASRMGAYAVDLLLENHDYSRGGFCVGVQNEKMVHE
LISVCIAPENKKSKFKEDWYDTAKKLF
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atggtcaagaaaatcggtgtactaacaagcggcggtgatgcgccagggatgaacgcagcc
attcgtggggttgttcgtgctgctttgtcagcaggattggaagtttacggtattgaagat
ggctatcttggcttgtttgagaatcgcatgaggaagctggaccgctatagcgtgtctgac
atgattaaccgcggtggtaccttcctcggttcagcgcgcttcccagagttccgtgatccg
gaaaaacgtaaagtcgccctacagaatatgaaagagcgtggcattgatggcctggtggtt
atcggtggtgacggttcttatgcaggtgcagacttgctgaccaaagaaggtggtattcac
tgtgtcggcttgccgggcaccattgataacgatgtggccgggactgactatactatcggt
ttcttcaccgcattgggtaccgtggtagaagctattgaccgcttacgtgatacctcttct
tcacaccagcgcatttccatcgttgaagtgatgggccgttattgtggcgatttgacactg
gcggcggcgattgccgggggctgcgagtttatcgcgatccctgaagttgaattcaaacgt
gaagatttggttgctgaaatcaaagcgggcatcgagaaaggtaaaaagcacgctatcgtt
gctattaccgaaaaactggacaatatcgatgagctggctaaatacattgaacaagaaacc
ggccgtgaaactcgtggcacagtgttaggccatatccaacgcggtggtgctccggttcct
tatgaccgtattctggcttcccgcatgggcgcttatgctgttgacctgttgttggaaaat
catgattactcacgcggcggcttctgcgttggtgtacagaacgagaagatggtgcatgaa
ttaatctccgtttgtatcgcgccagaaaacaagaaaagtaaatttaaagaagattggtac
gatacggcgaaaaaactgttctaa

DBGET integrated database retrieval system