KEGG   Yersinia enterocolitica subsp. palearctica Y11: Y11_29531Help
Entry
Y11_29531         CDS       T02010                                 

Definition
(GenBank) ribokinase
  KO
K00852  ribokinase [EC:2.7.1.15]
Organism
yey  Yersinia enterocolitica subsp. palearctica Y11
Pathway
yey00030  Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:yey00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Y11_29531
Enzymes [BR:yey01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Y11_29531
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB Phos_pyr_kin Carb_kinase
Motif
Other DBs
NCBI-ProteinID: CBY25228
UniProt: A0A0H3NWM8
Position
complement(3030713..3031639)
Genome map
AA seq 308 aa AA seqDB search
METGKLVVLGSINADHILNIEQFPRPGETVIGKQYKVAFGGKGANQAVAAGRSGANIAFI
ACVGEDDIGDRVRLQLASDNIDTAPIEVVAGTTTGVALIFVNGEGENVIGIHAGANSAVT
PEYLGRYQQQLIDADALLMQLESPLKTVIAAAKLAKQHQTQVILNPAPARELPDELLSLV
DMITPNETEAERLTGIHIEQDDDAARAAQILHDKGIATVIITLGSRGVWLSEQGQGKLVA
GFKVNAVDTIAAGDTFNGALLTALLEGQAMGSAVRFAHAAAAIAVTRPGAQPSIPWRAEI
DSFLQNRV
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atggaaacaggtaaattagtggtcttgggcagcatcaatgccgaccatattctgaatatt
gagcagtttccgcgtccaggtgaaacggtgatcgggaagcagtataaagttgctttcggc
ggcaaaggggctaatcaggccgttgctgctggccgtagtggggcgaatatcgcgtttatt
gcctgtgtgggtgaagatgatattggtgatcgggtacgtctgcaattagccagtgacaat
attgataccgcacctattgaggtggtagcaggcaccacgacaggggtagcgctgattttt
gttaatggtgaaggcgagaacgtcattggtattcatgctggggcaaactcggcagtaaca
ccggagtatcttggccgttatcaacagcaacttattgatgccgatgcattattgatgcaa
ctggaatctccacttaagacggttatcgccgccgccaaattggcaaaacagcatcaaact
caggttatcctgaatccggcccctgcacgcgaactacccgatgagctgttatcgctggtg
gatatgattactccaaatgaaacagaagctgagcgcttaaccggtattcatattgagcag
gatgatgacgcagcgagagccgcgcaaattttgcatgataaaggtatcgccactgtaatt
attactttgggcagccgtggtgtgtggcttagcgagcaaggtcagggcaaattagtcgct
ggctttaaagttaatgcagtagataccattgccgccggtgatacattcaatggcgcatta
ttgactgctttactggaaggccaagcaatgggttcagccgtccgttttgctcatgctgcg
gctgcgattgcagtgactcgccctggcgcacaaccttccattccttggcgggccgagatc
gatagtttcttacaaaatcgggtgtaa

DBGET integrated database retrieval system