KEGG   Yersinia enterocolitica subsp. palearctica Y11: Y11_30601Help
Entry
Y11_30601         CDS       T02010                                 

Definition
xylose isomerase (EC:5.3.1.5)
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
yey  Yersinia enterocolitica subsp. palearctica Y11
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:yey00040]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:yey00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3150747..3151763)
Genome map
AA seq 338 aa AA seqDB search
MSSYFDKLEQVRYEGSQSFNPLAFHHYNPDEIILGKRMADHLRFAACYWHTFCWGGADMF
GSNAFERPWQQSGDALALAKSKADVAFEFFHKLNVPYYCFHDVDVSPEGTSLKEYLNNFA
VMTDVLAEKQESSGVKLLWGTANCFTHPRYGAGAATNPNPEVFSWAATQVFTAMNATQKL
GGENYVLWGGREGYETLLNTDLRQEREQIGRFMQMVVEHKHKTGFQGTLLIEPKPQEPTK
HQYDYDVATVYGFLKQFGLEKEIKVNIEANHATLAGHSFHHEIASAIALGIFGSVDANRG
DPQLGWDTDQFPNSVEENALVMFEILKARWLYYRWAEL
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgtcatcttattttgataaattagaacaagtgcgttacgaaggcagccagagctttaac
ccactggcatttcatcactacaatccggatgaaattatccttggtaagcgaatggccgat
cacctaaggttcgctgcctgctactggcataccttctgctggggcggggcggatatgttt
ggcagcaatgcctttgagcgcccatggcaacaatctggagatgcattggctttggcaaaa
agtaaagctgatgtggcttttgaattcttccataaactgaatgtgccttattactgcttc
cacgatgtggatgtttcacccgaaggcacatcattaaaagaatatttaaataattttgcc
gtcatgactgatgtattagctgagaagcaagaaagtagcggcgtaaaattattatggggc
accgccaactgcttcacccacccgcgctacggtgccggggcggcgaccaatccaaatcca
gaagtttttagctgggcggcaacccaagtctttaccgccatgaatgccacccaaaaactc
ggtggggaaaactatgtgttgtggggcggacgcgaaggctatgaaacactgttaaataca
gatttacggcaagaacgtgagcaaattggccgctttatgcaaatggtggtcgaacataaa
cacaagacgggcttccagggcacattgttgatcgagccaaaaccacaagagccgactaag
catcagtatgattatgatgttgctacagtttatggtttcctcaagcagtttgggctagaa
aaagagattaaagttaacattgaagctaaccatgcgactttggctggacactctttccat
catgagattgccagtgcgattgcattaggtattttcggttcggtggatgctaaccgtggc
gatccacaattaggttgggataccgaccagttcccgaacagtgtggaagaaaatgcgctg
gtgatgtttgaaatcctcaaagccaggtggctttactaccggtgggctgaactttga

DBGET integrated database retrieval system