KEGG   Yersinia enterocolitica subsp. palearctica Y11: Y11_31221Help
Entry
Y11_31221         CDS       T02010                                 

Definition
endoglucanase (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
yey  Yersinia enterocolitica subsp. palearctica Y11
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:yey00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3222465..3223592
Genome map
AA seq 375 aa AA seqDB search
MVVMFKRLVCILLLLASFGTAAACDWPAWQQFKQHYISESGRVIDPSNPRKVTTSEGQSY
GLFFALVADDHETFDRLLTWTENNLSAGDLTARLPAWLWGQRNGHSWDILDPNSASDADL
WIAYSLLEAGRLWDTRRYQTMGTLLLQRIAKEEVVNIPGLGEMLLPGKIGFKNEDRWRLN
PSYLPPQLLARFSALAGPWKEMVKTNQRLWLETAPRGFSPDWVVWQKDKGWQPDETHPNL
GSYDAIRTYLWAGMLSNSSPQKAALIQHFQPMAEVTQQQGLPPEKADTLTGKTTGDGPVG
FSAALLPFLASSPAPFNQQALSQQQKRVQDSPPGADAYYSAVLTLFGQGWAQHRYSFNRQ
GELQPSWNSQCATLK
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atggtcgtgatgtttaaacgactggtatgcatcctactgctgcttgccagttttggtacc
gcagcagcttgtgattggccagcatggcagcagttcaaacaacactatatcagtgagtca
gggcgggttatcgaccccagcaacccgaggaaagtcaccacgtcggaggggcaaagttac
ggcttgttttttgcgctggtggctgatgatcacgagacattcgatcgattactcacttgg
acagaaaataacttgtcagcgggagatttgaccgcccgtctacctgcatggttatggggg
caacgtaatggccatagctgggatattttggatccaaattcggcttcggatgcggattta
tggattgcttacagtttattagaggctggtcgattatgggatacccgccgttaccagact
atgggcaccttattattgcaacgcattgccaaagaagaagtggtgaatattcccggcttg
ggtgaaatgttattaccgggcaaaattggctttaagaatgaagaccgttggcggctcaac
ccaagctatttaccaccacaattgctggcacgtttttctgctctggctgggccgtggaaa
gagatggtgaaaaccaatcagcggctatggctggaaacagcaccgcgtggtttcagccct
gactgggtggtgtggcaaaaagataaaggctggcagccggatgaaactcacccaaatctc
ggtagctacgatgcgattcgtacttacttatgggccgggatgttatcaaatagcagtccg
caaaaggcggcacttatccaacacttccaaccgatggctgaagtcacccagcagcaaggt
ttgccaccagaaaaggccgacacgttgacgggcaaaacaaccggtgatgggccggttggc
ttttcggcggcattattaccgtttttagccagcagtcctgcaccgtttaatcagcaggcg
cttagccaacaacaaaaacgggtacaagattcacctccgggagccgatgcttactacagt
gcagtgctgacactgtttggtcagggatgggcacaacatcgttatagctttaatcggcag
ggtgagcttcagccctcatggaacagtcaatgcgcaacattaaaataa

DBGET integrated database retrieval system