KEGG   Yersinia enterocolitica subsp. palearctica Y11: Y11_31841Help
Entry
Y11_31841         CDS       T02010                                 

Definition
(GenBank) 1,4-alpha-glucan (glycogen) branching enzyme,GH-13-type
  KO
K00700  1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
yey  Yersinia enterocolitica subsp. palearctica Y11
Pathway
yey00500  Starch and sucrose metabolism
yey01100  Metabolic pathways
yey01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:yey00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Y11_31841
Enzymes [BR:yey01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Y11_31841
Exosome [BR:yey04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Y11_31841
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CBM_48 Alpha-amylase_C Alpha-amylase Glyco_hydro_70
Motif
Other DBs
NCBI-ProteinID: CBY29346
UniProt: A0A0H3NXJ7
Position
3302122..3304305
Genome map
AA seq 727 aa AA seqDB search
MSVLPDRQVINQIISGHYADPFSVLGMHQTERGLQVCALLPDAQEVWLIDTKTGRRVAQL
DCEDPRGFFAVQLTRRKNPFRYQFAVTWQESTQIIEDPYRFGTLLQDIDTWLLAEGTHLR
PYERLGAHLMSLDEVPGVSFAVWAPNAQRVSVVGEFNFWDGRRHPMRLRRENGIWELFLP
GVQAGQLYKFEIIDCHGQVRLKADPYAFKAQMRPETASLISPLPDVVENTPARQKANDLR
SPISIYEVHLGSWRRHTDNNFWLSYGELADQLVEYVKYMGFTHVELLPINEHPFDGSWGY
QPLGLYAPTRRFGTPQDFKDFVAKFHEAGINVILDWVPGHFPSDEHGLSTFDGTALYEYA
DPREGYHQDWNTLIYNYGRNEVRNYLAGNAFYWMERFGIDALRIDAVASMIYRDYSRAKG
QWVPNYYGGRENLEAIAFLRYTNHTIGVERPGGVTMAEESTDFPGVTLPPDAGGLGFNYK
WNMGWMHDTLNYMQCDPVHRKYHHNLMTFGMLYAYTENFILPISHDEVVHGKRSVLDRMP
GDAWQKFANLRAYYGFMWAHPGKKLLFMGCEFAQGREWNFDTSLDWHLLDDENGWHKGVQ
RWVRDLNHCYQQHAPLYELDYQPAGFEWLVVDDHENSVFAFLRRDADGNELIVISNFTPV
PRYNYRVGVPQSGHYREVLNSDSAFYRGSNMGNQGGIHSHPVSSHNHAHSLLLTLPPLST
IYLTRGG
NT seq 2184 nt NT seq  +upstreamnt  +downstreamnt
atgtcagtacttcccgaccgtcaggtgattaatcagattatttccggccattatgccgat
cctttttccgtattgggtatgcaccaaacagagcggggattacaggtgtgtgcgttattg
ccagatgcccaagaggtttggcttattgataccaagacggggcgtcgagtcgctcaattg
gattgtgaagatccccgtggtttttttgctgtacaacttacccgtcgtaaaaaccccttc
cgctatcaatttgctgttacctggcaagaaagtacacaaatcatcgaagatccctaccga
ttcggcactttattgcaggatatcgatacctggttattggctgaaggtacccatttgcgc
ccttatgaacgcttaggggcgcatttgatgagtctggacgaggtgccgggagtcagcttc
gctgtttgggcgccaaatgcccagcgtgtctctgtggtgggggaatttaacttttgggat
ggccgccgtcaccccatgcggctacggcgagaaaacggtatttgggagctattcctgccc
ggtgtgcaggcggggcagttgtataagtttgagataatagattgccacggtcaggtgcgg
ttaaaggcggatccctacgcctttaaagcccagatgcggccagaaacagcttcattgata
agtccgttgcccgatgtggtcgaaaatactcccgcccgacaaaaagccaatgacttgcgt
tcacctatttctatttatgaagtccatcttggctcgtggcgacgccataccgacaataat
ttttggcttagttatggcgaattagccgatcaattggtcgaatacgtcaaatatatgggc
tttacccatgtggaattgctgccgattaatgagcatccgtttgatggtagttggggctat
caaccactggggttatacgccccgacccgccggtttggcacaccacaagatttcaaagat
tttgtcgctaaattccatgaggccggaattaacgtcattctcgactgggttccgggtcat
ttccccagtgatgagcatggtttatcgacctttgatggaaccgcattatatgaatatgcc
gatccgcgtgaaggctaccatcaggactggaataccctgatttataactatggtcgcaat
gaagttcgcaactatttagcgggaaatgcattctactggatggagcgttttggcattgat
gcattacgtattgatgctgttgcttcaatgatttaccgcgattacagccgtgccaaaggg
caatgggtgcccaattattacggtgggcgcgaaaatctggaggcgattgccttcttgcgt
tacaccaaccacaccatcggtgttgagcgccccggtggtgtcactatggctgaggagtct
actgacttcccaggggtgacattgcctcctgatgcgggtggattgggctttaactacaag
tggaatatgggctggatgcatgacacgctcaattacatgcaatgtgaccctgttcaccgc
aaatatcatcataatctaatgactttcggtatgttatacgcctataccgagaactttatt
ttaccgatctctcacgatgaagtggtgcatggcaagcgttcagtccttgatcgtatgcca
ggtgatgcatggcagaaattcgctaacttgcgggcctattatgggtttatgtgggcgcat
ccgggcaaaaaactgctgtttatgggatgtgaattcgcccaagggcgtgagtggaatttc
gataccagcctggactggcatttgctggatgacgaaaacggctggcataagggagtacag
cgctgggttcgcgatcttaaccattgttatcagcagcatgcgccactctatgagttagat
taccaaccggctggctttgagtggttggtggtggatgaccatgaaaactcggtatttgct
ttcctgcgccgtgacgctgatggtaacgaactgattgttattagtaatttcacgccagtt
ccacgttacaactaccgcgtaggtgtcccgcagagcgggcattaccgtgaagtgttgaac
tctgattcagcgttctatcgtggcagcaatatgggtaatcagggcggtattcatagccac
ccggtgagcagccataaccacgcgcattcattgttgctaactctgccaccgctgtcgact
atttatctgacacggggggggtag

DBGET integrated database retrieval system