KEGG   Yersinia enterocolitica subsp. palearctica Y11: Y11_31971Help
Entry
Y11_31971         CDS       T02010                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
yey  Yersinia enterocolitica subsp. palearctica Y11
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:yey00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Y11_31971
Enzymes [BR:yey01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Y11_31971
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3323294..3325390
Genome map
AA seq 698 aa AA seqDB search
MDRKSLDQAATLAGIAANYINAHGKSQAISAQTKQQLLAAMGRTSMPPDSQTEKAPLPPV
KIFTFGSAMQLPMAGSGDYHWQLQTEKGDLHQGRISAKKTLTLPASLPQGYHRLVLEQGL
QQWQCSVIVAPKRCYEPDALLAGKKLWGACVQLYTLRSDHNWGIGDFGDLNQMLEQVGER
GGAFIGLNPIHALYPANPHSASPYSPSSRRWLNVIYIDVNRVDEFQHSEAAQIWWHQPET
QGALARARASEWVDYPQVMQLKLTALRLAFPLFTARKTKDARVQAFHRFVEQGGSSLHQQ
AAFDALHAHLSKNDPMMWGWPVWPEKYRDGHSSAVADFSREHADEVNFYLWLQWLAASQF
EDCFRASQTWKMPLGLYRDLAVGVAEGGAETWCDRELYCLKASVGAPPDILGPLGQNWGL
PPMDPHVMAARAYQPFIDLLRANMTSCGALRIDHVMALLRLWWIPYGQTADQGAYVKYPV
DDLLAILALESQRHRCMVIGEDLGTVPVEIVGKLRDSGVYSYKVLYFEHDSENTFRAPQS
YPVQAMATITTHDLPTLRGYWQSDDLTLGNKLGLYPDQQILKQLYLDRERAKQGLLEGLH
HYDCVPKKVGHKASLLSMSQVLNRGLQRYVADSASALLGLQPEDWLDMAAPVNIPGTTDE
YPNWRRKLTSSLEEMFADDQVNRLLKDLDKRRKNVSAG
NT seq 2097 nt NT seq  +upstreamnt  +downstreamnt
atggatcgtaaatcgctcgatcaagcagcgacactggcagggattgccgccaattatatt
aatgcgcatggtaagtcgcaggctatttcagcacaaaccaagcagcagttgttggcggcc
atgggacgcaccagtatgcccccagattctcagacagaaaaagcaccattaccaccggta
aaaatatttacttttggcagcgcaatgcaactgccaatggcgggatcaggcgattatcac
tggcagttacagaccgaaaaaggtgatttgcatcaagggcgtatcagcgccaaaaaaacg
ctgacattgccggcctcactgccgcaaggctatcaccgcttggtattggaacaaggctta
cagcagtggcagtgctcggttatcgtcgctccgaaacgttgctatgagccagatgccttg
ctggcagggaaaaaactctggggagcctgtgttcagttgtataccctgcgctccgatcat
aactggggtatcggtgattttggcgacctcaaccagatgttggagcaggtcggtgagcgc
ggtggggcctttattggtcttaacccgattcatgcactgtatccggccaacccacatagt
gccagcccttacagcccttcttcccggcgctggctgaatgtgatttatattgatgtcaat
cgcgtggatgaattccagcatagcgaggcggcgcagatctggtggcatcagcccgagaca
caaggcgcgctggcgagagcgcgtgccagtgaatgggttgattatccgcaggtcatgcag
ctcaagttgaccgctttgcgtttggctttcccactttttacggcgcgcaaaaccaaagat
gctcgggtacaggcattccatcgttttgttgaacagggtggaagtagcctgcatcaacag
gccgcttttgatgctttgcatgctcatttgagtaaaaacgaccccatgatgtggggctgg
ccagtatggccggaaaaatatcgtgatgggcacagcagtgctgtggctgatttcagtcgt
gagcatgctgatgaagtgaacttctatctgtggctacagtggttggcggccagccagttt
gaggactgcttccgtgccagccaaacatggaaaatgccgttggggttgtatcgcgatttg
gcggtaggtgttgcagaaggcggcgctgaaacttggtgcgatcgcgagttatattgcctt
aaagcctcagtgggagcgccgcccgatattttagggccgctgggccagaactgggggttg
ccaccaatggatccgcacgtcatggctgctcgcgcttatcagccttttattgatttgttg
cgggctaatatgaccagttgcggtgcgctgcgcattgatcacgtgatggcgttattgcgc
ttgtggtggattccttacggccaaaccgcggatcaaggggcttatgtcaaatacccggtc
gatgatctgctggcgatattagcgttagaaagtcagcgccatcgctgcatggtgattggt
gaagatttaggcacggtgccggttgagattgtcggtaagctgcgcgacagcggagtgtat
tcctataaagtgctctattttgagcatgacagcgaaaacacgttccgtgcgccacagtct
tatccggtacaagcgatggcaaccatcaccactcatgatctgccgacgctgcgcggttat
tggcaaagtgatgatttgacgttggggaataagctggggctatatccggaccaacagata
ttgaaacagctttatcttgatagggaacgtgcgaaacaaggcttgctggaagggttgcat
cattatgattgcgtgccaaagaaagtgggtcataaagcgtcgttgctgtcgatgagccag
gttcttaatcgtggattgcagcgctatgttgccgacagtgccagtgcattattgggtttg
cagccggaagattggctggatatggccgcgccggtcaacattcctggcaccactgatgag
tatccaaactggcggcgtaagttgacctcaagcttggaagagatgttcgcagacgaccag
gttaatcgtttattgaaagatttggataagcgccgcaagaatgtttcagcggggtga

DBGET integrated database retrieval system