KEGG   Yersinia enterocolitica subsp. palearctica Y11: Y11_34021Help
Entry
Y11_34021         CDS       T02010                                 

Definition
phospholipase A1 precursor; Outer membrane phospholipase A
Orthology
K01058  
phospholipase A1 [EC:3.1.1.32 3.1.1.4]
Organism
yey  Yersinia enterocolitica subsp. palearctica Y11
Pathway
Glycerophospholipid metabolism
Ether lipid metabolism
Arachidonic acid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:yey00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Y11_34021
   00565 Ether lipid metabolism
    Y11_34021
   00590 Arachidonic acid metabolism
    Y11_34021
   00591 Linoleic acid metabolism
    Y11_34021
   00592 alpha-Linolenic acid metabolism
    Y11_34021
Enzymes [BR:yey01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     Y11_34021
    3.1.1.32  phospholipase A1
     Y11_34021
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3522083..3522964
Genome map
AA seq 293 aa AA seqDB search
MMGRFWQILIALLLVPTLAQAEEATVEKIHDAPTVRGSIIAAMLQDHDNPFLLYPYETNY
LLYTYTSDINKDAISSYDWAQNAKKDEVKFQLSLGFPIWRGIAGDNSLLGASYTQRSWWQ
ASNSDESSPFRETNYEPQIFLAWATDYELAGWTFREVEFGYNHQSNGKADPTSRSWDRVY
TRLMAQRGNLEIDLKPWYRIPESDSKDDNPDINKYMGYYRLKVGYALGESVFSLDGRYNW
NTGYGGAEMGWSYPITKHVRFYAQVFSGYGESMIDYNFRQTRVGVGIMLNDVL
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgatgggtagattttggcagattttaatcgctttattactggtgccgactttggcgcag
gcagaagaagcaacggttgagaagattcatgacgcaccgacagtgcgtggcagtattatt
gcggcaatgttgcaagatcacgataatccgttcttgctttatccgtatgaaacaaactat
ttgttatacacctataccagcgatatcaataaagacgcgataagctcttatgattgggca
cagaatgccaagaaagacgaagttaaattccaactgagtttgggcttccccatctggcgc
ggtattgccggtgataactccttactgggcgcttcctatacacaacgttcttggtggcag
gcatccaatagtgatgaatcctcacccttccgtgaaaccaactacgaacctcagatattc
ctggcgtgggcgacagattatgagctggcgggctggacattccgcgaagtagaatttggt
tataatcaccagtctaacggtaaagctgatcctacctcacgtagctgggatcgcgtttat
acccgcctgatggcgcaacgtggcaacttggaaatcgacctaaagccttggtatcgtatc
cctgaaagcgacagcaaagatgacaacccggatatcaataaatacatgggttattatcgg
ttgaaagtgggttatgccttgggtgaaagtgtgttcagcctggatggccgttataactgg
aataccggttatggtggtgctgaaatgggctggagctacccaataaccaagcatgttcgt
ttctatgcccaagtgttcagtggttatggtgagtcaatgattgactataactttaggcaa
acacgggtgggtgtgggtatcatgttgaatgatgtcctttaa

DBGET integrated database retrieval system