KEGG   Yersinia enterocolitica subsp. palearctica Y11: Y11_34061Help
Entry
Y11_34061         CDS       T02010                                 

Definition
lysophospholipase L2 (EC:3.1.1.5)
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
yey  Yersinia enterocolitica subsp. palearctica Y11
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:yey00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Y11_34061
Enzymes [BR:yey01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Y11_34061
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3526433..3527488
Genome map
AA seq 351 aa AA seqDB search
MPLDNHMNNWLTREEQFAAFVNGPLLDFWQQRDEDEFLGVDNIPIRYVRFCSPQHTRVVV
VVPGRIESYVKYPEVAYDLFQQGYDVIVLDHRGQGRSGRILDDRNRGHVIKFDDYIEDFA
QLVQREITGSHYQQRFALAHSMGGAILTRYLAREPTVFNAVALCAPMFGIHLPMPGWLAH
RIVDWTEKHQKLRDYYAIGTGQWRPLPYVVNMLTHSRERYRRYLRQYADSPEIRVGGPTY
HWVRESLLVGEQIIAQADKITTPVLLLQASEDRVVHNPAHNAFTQAMTLAGHPCEGGQPK
LIKGARHEILFERDTLRAEALSAILRFFAQHHSSLQHKKPVGPQDSDTTRG
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgccgttagataatcacatgaataactggttgacccgcgaagagcagtttgctgctttt
gttaacggcccattgttagatttctggcagcagcgggatgaagatgagtttctgggggtc
gataatatccccattcgatatgttcgtttttgttcaccgcaacatacccgcgtggtggtg
gtagtgccaggccgcattgaaagttacgttaaatatcccgaagtggcttatgatctattc
cagcaaggctatgatgttattgtgttggatcatcgtgggcagggccgatctgggcgaata
cttgatgatcgtaaccgcgggcatgtgatcaaatttgatgattacatagaagattttgcg
cagctggtgcagcgtgagataaccggaagccattatcagcagcgttttgcattggcccac
tctatggggggggcgattctgacccgttatctggcgcgagaaccgacagtgtttaatgct
gtagcgctctgcgcacccatgtttggtatccatttgccgatgccgggctggctggctcat
cggattgtcgattggactgagaaacatcaaaagttgcgggattactatgcaataggcacc
gggcaatggcgaccattgccctatgtggtcaatatgctgactcacagccgcgagcgctat
cgccgctacttgcgccaatatgctgacagcccagaaatccgcgtcggcgggccaacctat
cattgggttcgtgaaagcctgctggtgggggagcaaattattgctcaagcagacaaaatt
accacaccggttctgttactacaggccagtgaggatcgggtagtacataacccggcccat
aatgcatttactcaggcaatgactctggcggggcacccttgcgaaggggggcagccgaag
ttaattaaaggcgcacgccatgagatcctgttcgaacgggacaccctgcgtgccgaggcg
ctaagcgccatattgcgcttttttgcgcaacatcactcttctttacaacataaaaaacca
gtcggccctcaagactccgacaccaccagaggttag

DBGET integrated database retrieval system