KEGG   Yersinia enterocolitica subsp. palearctica Y11: Y11_34701Help
Entry
Y11_34701         CDS       T02010                                 

Definition
(GenBank) porphobilinogen synthase
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
yey  Yersinia enterocolitica subsp. palearctica Y11
Pathway
yey00860  Porphyrin and chlorophyll metabolism
yey01100  Metabolic pathways
yey01110  Biosynthesis of secondary metabolites
yey01120  Microbial metabolism in diverse environments
Module
yey_M00121  Heme biosynthesis, glutamate => heme
yey_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:yey00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Y11_34701
Enzymes [BR:yey01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Y11_34701
Exosome [BR:yey04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Y11_34701
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD
Motif
Other DBs
NCBI-ProteinID: CBY29060
UniProt: A0A0H3NZ15
Position
3589819..3590841
Genome map
AA seq 340 aa AA seqDB search
MSYAFPGTFPGRRMRRVRRHDFSRRLVAENQLTVNDLIYPVFVMEGHNQQQAVSSMPGVS
RMTIDLLVKEAEAIAKLGVPVISLFPVIEPGMKSLQAEEAYNPNGLVQRTVRALKDAVPE
LGILTDVALDPYTTHGQDGVVDADGYVINDITKEIIVRQALSHADAGAEIVAPSDMMDGR
IGAIRDQLELQGLVNTQIMAYSAKYASCYYGPFRDAIGSSSNLKGGNKKTYQMDPANSDE
ALQEIAQDLQEGADMVMVKPGMPYLDVVRRVKDTFGVPTFAYQVSGEYAMHMAAIQNGWL
QEKPTVMESLLCFKRAGADGVLTYFAKQVAQWLHDDQMQR
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgagctatgcatttccgggcaccttccctggtcgccgtatgcgccgtgtgcgccgtcat
gatttcagtcgtcgactggtcgctgaaaatcagctgacagttaatgatttgatctatccg
gtgtttgttatggaaggacacaaccagcagcaagctgtttcgtctatgccgggtgtctcg
cgtatgacgattgatttgttggtgaaagaagctgaggccattgccaagcttggcgtcccg
gtcatatcgttattcccggtcattgaaccaggtatgaagtcactacaggcggaagaagct
tataacccgaatggcctggtacaacgtactgtacgtgcattaaaagacgctgtaccagag
ttaggtattcttacggatgttgccctcgacccatacacaacccatgggcaagacggtgtg
gttgatgctgatggttatgtcattaacgatatcaccaaagaaattatagtgcgtcaggcc
ttatcacatgcagacgctggcgcagagattgttgccccgagcgatatgatggatggccgc
attggtgctattcgcgatcagttagaacttcaagggctagttaatacacaaatcatggcg
tattcagccaagtatgcctcttgttactatggcccattccgcgatgcaattggctccagt
agcaatttgaaaggtggcaataaaaaaacctatcaaatggacccggccaatagcgatgag
gcgttgcaagaaatcgctcaggacttgcaggaaggggcggatatggtgatggttaaaccg
ggtatgccatatttggatgtggtgcgccgggtgaaagatacctttggggttccgaccttt
gcctatcaggtttctggtgaatatgcgatgcatatggctgcaatacaaaatggctggctg
caagagaaaccgacggtgatggagtcactattgtgctttaaacgcgcaggtgcggatggg
gtattaacctattttgctaagcaagtcgcacaatggctgcatgacgatcagatgcagcgt
taa

DBGET integrated database retrieval system