KEGG   Yersinia enterocolitica subsp. palearctica Y11: Y11_36361Help
Entry
Y11_36361         CDS       T02010                                 

Definition
(RefSeq) 3'(2'),5'-bisphosphate nucleotidase (EC:3.1.3.7)
  KO
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
yey  Yersinia enterocolitica subsp. palearctica Y11
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:yey00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Y11_36361
Enzymes [BR:yey01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     Y11_36361
Transfer RNA biogenesis [BR:yey03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    Y11_36361
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3771213..3771953
Genome map
AA seq 246 aa AA seqDB search
MLEQICQLAHEAGVAIMAVYQGEKPLDVAHKKDDSPVTAADLAAHQIIKAGLAALTPDIP
LLSEEDPPTWAVRQHWQRYWLVDPLDGTKEFLSRNGEFTVNIALIDQGVAVLGVVYAPAS
EVMYSAENGQAWKEECGRRMQIEVRDAVPPLVVVSRSHSDAELEDYLAQLGEHQTVAVGS
SLKFCLVAEGKAQLYPRFGPTNVWDTAAGHAVAIAAGAQVHDWQGKPLSYIPRESFLNPG
FRVSLF
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgttagagcaaatttgccagttggcccacgaggcaggcgtggcgattatggcggtctat
cagggggagaagccccttgatgtggcccataaaaaagatgattcgcccgttacggcggcg
gatcttgcagcccatcaaattatcaaagccgggttggcggcattgacccctgacattcct
ctgttatctgaagaggatccacctacttgggcagtgcgccagcactggcagcgctattgg
ttggttgacccactggatggcaccaaagaatttttgagccgcaatggcgaattcaccgtc
aatatcgccctgattgaccaaggggtagcagtgttgggggtagtttatgctccggcgagc
gaagtgatgtatagcgcggaaaacggccaggcatggaaagaagagtgtggtcggcgtatg
cagattgaggtgcgtgatgccgttccgccgctggtggttgtcagccgttctcacagtgat
gctgagttggaagattatttggcgcaattgggcgaacatcagacggtagcggttggttca
tcactcaagttttgtttggtcgctgaaggaaaagcgcaactatatcctcgctttgggccg
accaatgtgtgggataccgccgctgggcatgcagtcgccatagctgccggggcacaagtt
cacgattggcagggtaaaccactttcttatatcccacgtgaatctttcctgaaccccggc
tttagagtgtctttgttctag

DBGET integrated database retrieval system